Recombinant Human GLP2R Protein(1-173aa), His-tagged

• Cat.No.: GLP2R-1105H
• Product Overview: Recombinant Human GLP2R Protein(O95838)(1-173aa), fused with C-terminal 10xHis tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 1-173aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 22.0 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MKLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRPFLTLVLLVSIKQVTGSLLEETTRKWAQYKQACLRDLLKEPSGIFCNGTFDQYVCWPHSSPGNVSVPCPSYLPWWSEESSGRAYRHCLAQGTWQTIENATDIWQDDSECSENHSFKQNVDRYA

Gene Information

• Gene Name: GLP2R glucagon-like peptide 2 receptor [ Homo sapiens ]
• Official Symbol: GLP2R
• Synonyms: GLP2R; glucagon-like peptide 2 receptor; GLP-2R; GLP-2-R; GLP-2 receptor
• Gene ID: 9340
• mRNA Refseq: NM_004246
• Protein Refseq: P_004237
• MIM: 603659
• UniProt ID: O95838