Recombinant Human GLP2R Protein(1-173aa), His-tagged

Cat.No. : GLP2R-1105H
Product Overview : Recombinant Human GLP2R Protein(O95838)(1-173aa), fused with C-terminal 10xHis tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 1-173aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 22.0 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : MKLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRPFLTLVLLVSIKQVTGSLLEETTRKWAQYKQACLRDLLKEPSGIFCNGTFDQYVCWPHSSPGNVSVPCPSYLPWWSEESSGRAYRHCLAQGTWQTIENATDIWQDDSECSENHSFKQNVDRYA
Gene Name GLP2R glucagon-like peptide 2 receptor [ Homo sapiens ]
Official Symbol GLP2R
Synonyms GLP2R; glucagon-like peptide 2 receptor; GLP-2R; GLP-2-R; GLP-2 receptor
Gene ID 9340
mRNA Refseq NM_004246
Protein Refseq P_004237
MIM 603659
UniProt ID O95838

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLP2R Products

Required fields are marked with *

My Review for All GLP2R Products

Required fields are marked with *

0
cart-icon
0
compare icon