Recombinant Human GLP2R Protein(1-173aa), His-tagged
Cat.No. : | GLP2R-1105H |
Product Overview : | Recombinant Human GLP2R Protein(O95838)(1-173aa), fused with C-terminal 10xHis tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-173aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 22.0 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MKLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRPFLTLVLLVSIKQVTGSLLEETTRKWAQYKQACLRDLLKEPSGIFCNGTFDQYVCWPHSSPGNVSVPCPSYLPWWSEESSGRAYRHCLAQGTWQTIENATDIWQDDSECSENHSFKQNVDRYA |
Gene Name | GLP2R glucagon-like peptide 2 receptor [ Homo sapiens ] |
Official Symbol | GLP2R |
Synonyms | GLP2R; glucagon-like peptide 2 receptor; GLP-2R; GLP-2-R; GLP-2 receptor |
Gene ID | 9340 |
mRNA Refseq | NM_004246 |
Protein Refseq | P_004237 |
MIM | 603659 |
UniProt ID | O95838 |
◆ Recombinant Proteins | ||
RFL8221MF | Recombinant Full Length Mouse Glucagon-Like Peptide 2 Receptor(Glp2R) Protein, His-Tagged | +Inquiry |
GLP2R-1106HFL | Recombinant Human GLP2R protein, His&Flag-tagged | +Inquiry |
GLP2R-1106H | Recombinant Human GLP2R Protein(Met1-Ala173), His-tagged | +Inquiry |
GLP2R-6415M | Recombinant Mouse GLP2R Protein | +Inquiry |
GLP2R-33H | Recombinant Human GLP2R Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLP2R Products
Required fields are marked with *
My Review for All GLP2R Products
Required fields are marked with *