Recombinant Human GLRA1
Cat.No. : | GLRA1-27289TH |
Product Overview : | Recombinant fragment of Human alpha 1 Glycine Receptor (amino acids 121-220) with N terminal proprietary tag, 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The protein encoded by this gene is a subunit of a pentameric inhibitory glycine receptor. The receptor mediates postsynaptic inhibition in the central nervous system. Defects in this gene are a cause of startle disease (STHE), also known as hereditary hyperekplexia or congenital stiff-person syndrome. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | IWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEE |
Sequence Similarities : | Belongs to the ligand-gated ion channel (TC 1.A.9) family. Glycine receptor (TC 1.A.9.3) subfamily. GLRA1 sub-subfamily. |
Gene Name | GLRA1 glycine receptor, alpha 1 [ Homo sapiens ] |
Official Symbol | GLRA1 |
Synonyms | GLRA1; glycine receptor, alpha 1; glycine receptor, alpha 1 (startle disease/hyperekplexia) , STHE; glycine receptor subunit alpha-1; startle disease/hyperekplexia; stiff person syndrome; |
Gene ID | 2741 |
mRNA Refseq | NM_000171 |
Protein Refseq | NP_000162 |
MIM | 138491 |
Uniprot ID | P23415 |
Chromosome Location | 5q31-q33 |
Pathway | Ion channel transport, organism-specific biosystem; Ligand-gated ion channel transport, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand-receptor interaction, conserved biosystem; Transmembrane transport of small molecules, organism-specific biosystem; |
Function | extracellular ligand-gated ion channel activity; extracellular-glycine-gated chloride channel activity; contributes_to extracellular-glycine-gated chloride channel activity; extracellular-glycine-gated chloride channel activity; glycine binding; |
◆ Recombinant Proteins | ||
GLRA1-5343HF | Recombinant Full Length Human GLRA1 Protein, GST-tagged | +Inquiry |
GLRA1-4970H | Recombinant Human GLRA1 Protein, GST-tagged | +Inquiry |
GLRA1-4344H | Recombinant Human GLRA1 protein, His&Myc-tagged | +Inquiry |
GLRA1-2567R | Recombinant Rat GLRA1 Protein | +Inquiry |
GLRA1-1691R | Recombinant Rhesus Macaque GLRA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLRA1-712HCL | Recombinant Human GLRA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GLRA1 Products
Required fields are marked with *
My Review for All GLRA1 Products
Required fields are marked with *
0
Inquiry Basket