Recombinant Human GLRX Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : GLRX-5205H
Product Overview : GLRX MS Standard C13 and N15-labeled recombinant protein (NP_001112362) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the glutaredoxin family. The encoded protein is a cytoplasmic enzyme catalyzing the reversible reduction of glutathione-protein mixed disulfides. This enzyme highly contributes to the antioxidant defense system. It is crucial for several signalling pathways by controlling the S-glutathionylation status of signalling mediators. It is involved in beta-amyloid toxicity and Alzheimer's disease. Multiple alternatively spliced transcript variants encoding the same protein have been identified.
Molecular Mass : 11.8 kDa
AA Sequence : MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name GLRX glutaredoxin [ Homo sapiens (human) ]
Official Symbol GLRX
Synonyms GLRX; glutaredoxin (thioltransferase); glutaredoxin-1; GRX; GRX1; TTase-1; thioltransferase-1; FLJ43648; MGC117407;
Gene ID 2745
mRNA Refseq NM_001118890
Protein Refseq NP_001112362
MIM 600443
UniProt ID P35754

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLRX Products

Required fields are marked with *

My Review for All GLRX Products

Required fields are marked with *

0
cart-icon