Recombinant Human GLTP Protein, GST-tagged

Cat.No. : GLTP-4987H
Product Overview : Human GLTP partial ORF ( NP_057517, 110 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is similar to bovine and porcine proteins which accelerate transfer of certain glycosphingolipids and glyceroglycolipids between membranes. It is thought to be a cytoplasmic protein. [provided by RefSeq
Molecular Mass : 36.74 kDa
AA Sequence : SICDGERDENHPNLIRVNATKAYEMALKKYHGWIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKIRLFLVNYTATIDVIYEMYTQMNAELNYKV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GLTP glycolipid transfer protein [ Homo sapiens ]
Official Symbol GLTP
Synonyms GLTP; colipid transfer protein; glycolipid transfer protein; truncated glycolipid transfer protein
Gene ID 51228
mRNA Refseq NM_016433
Protein Refseq NP_057517
MIM 608949
UniProt ID Q9NZD2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLTP Products

Required fields are marked with *

My Review for All GLTP Products

Required fields are marked with *

0
cart-icon
0
compare icon