Recombinant Human GLTP Protein, GST-tagged
| Cat.No. : | GLTP-4987H |
| Product Overview : | Human GLTP partial ORF ( NP_057517, 110 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is similar to bovine and porcine proteins which accelerate transfer of certain glycosphingolipids and glyceroglycolipids between membranes. It is thought to be a cytoplasmic protein. [provided by RefSeq |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | SICDGERDENHPNLIRVNATKAYEMALKKYHGWIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKIRLFLVNYTATIDVIYEMYTQMNAELNYKV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GLTP glycolipid transfer protein [ Homo sapiens ] |
| Official Symbol | GLTP |
| Synonyms | GLTP; colipid transfer protein; glycolipid transfer protein; truncated glycolipid transfer protein |
| Gene ID | 51228 |
| mRNA Refseq | NM_016433 |
| Protein Refseq | NP_057517 |
| MIM | 608949 |
| UniProt ID | Q9NZD2 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLTP Products
Required fields are marked with *
My Review for All GLTP Products
Required fields are marked with *
