Recombinant Human GLTP Protein, GST-tagged
Cat.No. : | GLTP-4987H |
Product Overview : | Human GLTP partial ORF ( NP_057517, 110 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is similar to bovine and porcine proteins which accelerate transfer of certain glycosphingolipids and glyceroglycolipids between membranes. It is thought to be a cytoplasmic protein. [provided by RefSeq |
Molecular Mass : | 36.74 kDa |
AA Sequence : | SICDGERDENHPNLIRVNATKAYEMALKKYHGWIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKIRLFLVNYTATIDVIYEMYTQMNAELNYKV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GLTP glycolipid transfer protein [ Homo sapiens ] |
Official Symbol | GLTP |
Synonyms | GLTP; colipid transfer protein; glycolipid transfer protein; truncated glycolipid transfer protein |
Gene ID | 51228 |
mRNA Refseq | NM_016433 |
Protein Refseq | NP_057517 |
MIM | 608949 |
UniProt ID | Q9NZD2 |
◆ Recombinant Proteins | ||
GLTP-1763B | Recombinant Bovine GLTP Protein (2-209 aa), His-SUMO-tagged | +Inquiry |
GLTP-1879R | Recombinant Rhesus monkey GLTP Protein, His-tagged | +Inquiry |
GLTP-2577R | Recombinant Rat GLTP Protein | +Inquiry |
GLTP-3540H | Recombinant Human GLTP Protein (Met1-Val209), N-GST tagged | +Inquiry |
GLTP-4908C | Recombinant Chicken GLTP | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLTP-5893HCL | Recombinant Human GLTP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GLTP Products
Required fields are marked with *
My Review for All GLTP Products
Required fields are marked with *
0
Inquiry Basket