Recombinant Human GLUL Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | GLUL-1059H |
| Product Overview : | GLUL MS Standard C13 and N15-labeled recombinant protein (NP_002056) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene belongs to the glutamine synthetase family. It catalyzes the synthesis of glutamine from glutamate and ammonia in an ATP-dependent reaction. This protein plays a role in ammonia and glutamate detoxification, acid-base homeostasis, cell signaling, and cell proliferation. Glutamine is an abundant amino acid, and is important to the biosynthesis of several amino acids, pyrimidines, and purines. Mutations in this gene are associated with congenital glutamine deficiency, and overexpression of this gene was observed in some primary liver cancer samples. There are six pseudogenes of this gene found on chromosomes 2, 5, 9, 11, and 12. Alternative splicing results in multiple transcript variants. |
| Molecular Mass : | 42.1 kDa |
| AA Sequence : | MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | GLUL glutamate-ammonia ligase [ Homo sapiens (human) ] |
| Official Symbol | GLUL |
| Synonyms | GLUL; glutamate-ammonia ligase; GLNS, glutamate ammonia ligase (glutamine synthase); glutamine synthetase; glutamine synthase; glutamate decarboxylase; glutamate--ammonia ligase; proliferation-inducing protein 43; cell proliferation-inducing protein 59; GS; GLNS; PIG43; PIG59; |
| Gene ID | 2752 |
| mRNA Refseq | NM_002065 |
| Protein Refseq | NP_002056 |
| MIM | 138290 |
| UniProt ID | P15104 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLUL Products
Required fields are marked with *
My Review for All GLUL Products
Required fields are marked with *



