Recombinant Human GLYAT Protein, GST-tagged
| Cat.No. : | GLYAT-4995H |
| Product Overview : | Human GLYAT full-length ORF ( AAH09785.1, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The glycine-N-acyltransferase protein conjugates glycine with acyl-CoA substrates in the mitochondria. The protein is thought to be important in the detoxification of endogenous and xenobiotic acyl-CoAs. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
| Molecular Mass : | 44.9 kDa |
| AA Sequence : | MMLPLQGAQMLQMLEKTLRKSLPASLKVYGTVFHINHGNPFNLKAVVDKWPDFNTVVVCPQEQDMTDDLDHYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAAIKSFKVKQTQRILYMAAETAKELTPFLLKSKILSPSGGKPKAM |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GLYAT glycine-N-acyltransferase [ Homo sapiens ] |
| Official Symbol | GLYAT |
| Synonyms | GLYAT; glycine-N-acyltransferase; glycine N-acyltransferase; ACGNAT; GAT; AAc; HRP-1(CLP); aralkyl-CoA N-acyltransferase; acyl-CoA:glycine N-acyltransferase; aralkyl acyl-CoA N-acyltransferase; aralkyl acyl-CoA:amino acid N-acyltransferase; CAT; |
| Gene ID | 10249 |
| mRNA Refseq | NM_005838 |
| Protein Refseq | NP_005829 |
| MIM | 607424 |
| UniProt ID | Q6IB77 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLYAT Products
Required fields are marked with *
My Review for All GLYAT Products
Required fields are marked with *



