Recombinant Human GLYAT Protein, GST-tagged
Cat.No. : | GLYAT-4995H |
Product Overview : | Human GLYAT full-length ORF ( AAH09785.1, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The glycine-N-acyltransferase protein conjugates glycine with acyl-CoA substrates in the mitochondria. The protein is thought to be important in the detoxification of endogenous and xenobiotic acyl-CoAs. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 44.9 kDa |
AA Sequence : | MMLPLQGAQMLQMLEKTLRKSLPASLKVYGTVFHINHGNPFNLKAVVDKWPDFNTVVVCPQEQDMTDDLDHYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAAIKSFKVKQTQRILYMAAETAKELTPFLLKSKILSPSGGKPKAM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GLYAT glycine-N-acyltransferase [ Homo sapiens ] |
Official Symbol | GLYAT |
Synonyms | GLYAT; glycine-N-acyltransferase; glycine N-acyltransferase; ACGNAT; GAT; AAc; HRP-1(CLP); aralkyl-CoA N-acyltransferase; acyl-CoA:glycine N-acyltransferase; aralkyl acyl-CoA N-acyltransferase; aralkyl acyl-CoA:amino acid N-acyltransferase; CAT; |
Gene ID | 10249 |
mRNA Refseq | NM_005838 |
Protein Refseq | NP_005829 |
MIM | 607424 |
UniProt ID | Q6IB77 |
◆ Recombinant Proteins | ||
GLYAT-6441M | Recombinant Mouse GLYAT Protein | +Inquiry |
GLYAT-3617M | Recombinant Mouse GLYAT Protein, His (Fc)-Avi-tagged | +Inquiry |
GLYAT-5362HF | Recombinant Full Length Human GLYAT Protein, GST-tagged | +Inquiry |
GLYAT-3574H | Recombinant Human GLYAT, His-tagged | +Inquiry |
GLYAT-1703R | Recombinant Rhesus Macaque GLYAT Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLYAT-5889HCL | Recombinant Human GLYAT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GLYAT Products
Required fields are marked with *
My Review for All GLYAT Products
Required fields are marked with *
0
Inquiry Basket