Recombinant Human GLYAT Protein, GST-tagged

Cat.No. : GLYAT-4995H
Product Overview : Human GLYAT full-length ORF ( AAH09785.1, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The glycine-N-acyltransferase protein conjugates glycine with acyl-CoA substrates in the mitochondria. The protein is thought to be important in the detoxification of endogenous and xenobiotic acyl-CoAs. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Molecular Mass : 44.9 kDa
AA Sequence : MMLPLQGAQMLQMLEKTLRKSLPASLKVYGTVFHINHGNPFNLKAVVDKWPDFNTVVVCPQEQDMTDDLDHYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAAIKSFKVKQTQRILYMAAETAKELTPFLLKSKILSPSGGKPKAM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GLYAT glycine-N-acyltransferase [ Homo sapiens ]
Official Symbol GLYAT
Synonyms GLYAT; glycine-N-acyltransferase; glycine N-acyltransferase; ACGNAT; GAT; AAc; HRP-1(CLP); aralkyl-CoA N-acyltransferase; acyl-CoA:glycine N-acyltransferase; aralkyl acyl-CoA N-acyltransferase; aralkyl acyl-CoA:amino acid N-acyltransferase; CAT;
Gene ID 10249
mRNA Refseq NM_005838
Protein Refseq NP_005829
MIM 607424
UniProt ID Q6IB77

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLYAT Products

Required fields are marked with *

My Review for All GLYAT Products

Required fields are marked with *

0
cart-icon