Recombinant Human GM2A protein, GST-tagged
| Cat.No. : | GM2A-2973H |
| Product Overview : | Recombinant Human GM2A protein(P17900)(32-193aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 32-193aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 44.6 kDa |
| AA Sequence : | SSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | GM2A GM2 ganglioside activator [ Homo sapiens ] |
| Official Symbol | GM2A |
| Synonyms | GM2A; GM2 ganglioside activator; GM2 ganglioside activator protein; ganglioside GM2 activator; cerebroside sulfate activator protein; SAP 3; sphingolipid activator protein 3; shingolipid activator protein 3; SAP-3; GM2-AP; |
| Gene ID | 2760 |
| mRNA Refseq | NM_000405 |
| Protein Refseq | NP_000396 |
| MIM | 613109 |
| UniProt ID | P17900 |
| ◆ Recombinant Proteins | ||
| GM2A-2558Z | Recombinant Zebrafish GM2A | +Inquiry |
| GM2A-521H | Recombinant Human GM2A Protein, His-tagged | +Inquiry |
| GM2A-993H | Recombinant Human GM2A Protein, His (Fc)-Avi-tagged | +Inquiry |
| GM2A-5001H | Recombinant Human GM2A Protein, GST-tagged | +Inquiry |
| GM2A-1665HFL | Recombinant Full Length Human GM2A Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GM2A-450HCL | Recombinant Human GM2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GM2A Products
Required fields are marked with *
My Review for All GM2A Products
Required fields are marked with *
