Recombinant Human GMEB1 protein, GST-tagged
Cat.No. : | GMEB1-7876H |
Product Overview : | Recombinant Human GMEB1 protein(216-387 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 216-387 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | AISEESMEEAGLEWNSALTAAVTMATEEGVKKDSEEISEDTLMFWKGIADVGLMEEVVCNIQKEIEELLRGVQQRLIQAPFQVTDAAVLNNVAHTFGLMDTVKKVLDNRRNQVEQGEEQFLYTLTDLERQLEEQKKQGQDHRLKSQTVQNVVLMPVSTPKPPKRPRLQRPAS |
Purity : | 90%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | GMEB1 glucocorticoid modulatory element binding protein 1 [ Homo sapiens ] |
Official Symbol | GMEB1 |
Synonyms | GMEB1; glucocorticoid modulatory element binding protein 1; glucocorticoid modulatory element-binding protein 1; P96PIF; PIF96; GMEB-1; PIF p96; DNA-binding protein p96PIF; parvovirus initiation factor p96; |
mRNA Refseq | NM_006582 |
Protein Refseq | NP_006573 |
MIM | 604409 |
UniProt ID | Q9Y692 |
Gene ID | 10691 |
◆ Recombinant Proteins | ||
GMEB1-7876H | Recombinant Human GMEB1 protein, GST-tagged | +Inquiry |
GMEB1-5006H | Recombinant Human GMEB1 Protein, GST-tagged | +Inquiry |
GMEB1-5405HF | Recombinant Full Length Human GMEB1 Protein, GST-tagged | +Inquiry |
GMEB1-570H | Recombinant Human GMEB1 Protein, His-tagged | +Inquiry |
GMEB1-7931Z | Recombinant Zebrafish GMEB1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GMEB1-5884HCL | Recombinant Human GMEB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GMEB1 Products
Required fields are marked with *
My Review for All GMEB1 Products
Required fields are marked with *