Recombinant Human GMEB1 protein, GST-tagged

• Cat.No.: GMEB1-301598H
• Product Overview: Recombinant Human GMEB1 (206-377 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Ala206-Ser377
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: AISEESMEEAGLEWNSALTAAVTMATEEGVKKDSEEISEDTLMFWKGIADVGLMEEVVCNIQKEIEELLRGVQQRLIQAPFQVTDAAVLNNVAHTFGLMDTVKKVLDNRRNQVEQGEEQFLYTLTDLERQLEEQKKQGQDHRLKSQTVQNVVLMPVSTPKPPKRPRLQRPA
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: GMEB1 glucocorticoid modulatory element binding protein 1 [ Homo sapiens ]
• Official Symbol: GMEB1
• Synonyms: GMEB1; glucocorticoid modulatory element binding protein 1; glucocorticoid modulatory element-binding protein 1; P96PIF; PIF96; GMEB-1; PIF p96; DNA-binding protein p96PIF; parvovirus initiation factor p96
• Gene ID: 10691
• mRNA Refseq: NM_006582
• Protein Refseq: NP_006573
• MIM: 604409
• UniProt ID: Q9Y692