Recombinant Human GMEB1 protein, GST-tagged
Cat.No. : | GMEB1-301598H |
Product Overview : | Recombinant Human GMEB1 (206-377 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ala206-Ser377 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | AISEESMEEAGLEWNSALTAAVTMATEEGVKKDSEEISEDTLMFWKGIADVGLMEEVVCNIQKEIEELLRGVQQRLIQAPFQVTDAAVLNNVAHTFGLMDTVKKVLDNRRNQVEQGEEQFLYTLTDLERQLEEQKKQGQDHRLKSQTVQNVVLMPVSTPKPPKRPRLQRPA |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | GMEB1 glucocorticoid modulatory element binding protein 1 [ Homo sapiens ] |
Official Symbol | GMEB1 |
Synonyms | GMEB1; glucocorticoid modulatory element binding protein 1; glucocorticoid modulatory element-binding protein 1; P96PIF; PIF96; GMEB-1; PIF p96; DNA-binding protein p96PIF; parvovirus initiation factor p96; |
Gene ID | 10691 |
mRNA Refseq | NM_006582 |
Protein Refseq | NP_006573 |
MIM | 604409 |
UniProt ID | Q9Y692 |
◆ Recombinant Proteins | ||
GMEB1-5006H | Recombinant Human GMEB1 Protein, GST-tagged | +Inquiry |
GMEB1-5405HF | Recombinant Full Length Human GMEB1 Protein, GST-tagged | +Inquiry |
GMEB1-570H | Recombinant Human GMEB1 Protein, His-tagged | +Inquiry |
GMEB1-7876H | Recombinant Human GMEB1 protein, GST-tagged | +Inquiry |
GMEB1-2238R | Recombinant Rat GMEB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GMEB1-5884HCL | Recombinant Human GMEB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GMEB1 Products
Required fields are marked with *
My Review for All GMEB1 Products
Required fields are marked with *