Recombinant Human GMEB2 protein, His-tagged

• Cat.No.: GMEB2-13332H
• Product Overview: Recombinant Human GMEB2 protein(1-304 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-304 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AASequence: MATPDVSVHMEEVVVVTTPDTAVDGSGVEGVKTVLVTTNLAPHGGDLTEDNMETENAAAAAAAAFTASSQLKEAVLVKMAEEGENLEAEIVYPITCGDSRANLIWRKFVCPGINVKCVQYDEHVISPKEFVHLAGKSTLKDWKRAIRMNGIMLRKIMDSGELDFYQHDKVCSNTCRSTKIDLSGARVSLSSPTSAEYIPLTPAAADVNGSPATITIETCEDPGDWTAAIGDDTFTFWRGLKDAGLLDEVIQEFHQELVETMRGLQQRVQDPPLQLRDAVLLNNIVQNFGMLDLVKKVLASHKCQ
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: GMEB2 glucocorticoid modulatory element binding protein 2 [ Homo sapiens ]
• Official Symbol: GMEB2
• Synonyms: GMEB2; glucocorticoid modulatory element binding protein 2; glucocorticoid modulatory element-binding protein 2; KIAA1269; P79PIF; PIF79; GMEB-2; PIF p79; DNA-binding protein p79PIF; parvovirus initiation factor p79; parvovirus initiation factor, p79
• Gene ID: 26205
• mRNA Refseq: NM_012384
• Protein Refseq: NP_036516
• MIM: 607451
• UniProt ID: Q9UKD1