Recombinant Human GMEB2 protein, His-tagged
| Cat.No. : | GMEB2-13332H |
| Product Overview : | Recombinant Human GMEB2 protein(1-304 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | July 28, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-304 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | MATPDVSVHMEEVVVVTTPDTAVDGSGVEGVKTVLVTTNLAPHGGDLTEDNMETENAAAAAAAAFTASSQLKEAVLVKMAEEGENLEAEIVYPITCGDSRANLIWRKFVCPGINVKCVQYDEHVISPKEFVHLAGKSTLKDWKRAIRMNGIMLRKIMDSGELDFYQHDKVCSNTCRSTKIDLSGARVSLSSPTSAEYIPLTPAAADVNGSPATITIETCEDPGDWTAAIGDDTFTFWRGLKDAGLLDEVIQEFHQELVETMRGLQQRVQDPPLQLRDAVLLNNIVQNFGMLDLVKKVLASHKCQ |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | GMEB2 glucocorticoid modulatory element binding protein 2 [ Homo sapiens ] |
| Official Symbol | GMEB2 |
| Synonyms | GMEB2; glucocorticoid modulatory element binding protein 2; glucocorticoid modulatory element-binding protein 2; KIAA1269; P79PIF; PIF79; GMEB-2; PIF p79; DNA-binding protein p79PIF; parvovirus initiation factor p79; parvovirus initiation factor, p79; |
| Gene ID | 26205 |
| mRNA Refseq | NM_012384 |
| Protein Refseq | NP_036516 |
| MIM | 607451 |
| UniProt ID | Q9UKD1 |
| ◆ Recombinant Proteins | ||
| GMEB2-13332H | Recombinant Human GMEB2 protein, His-tagged | +Inquiry |
| GMEB2-5008H | Recombinant Human GMEB2 Protein, GST-tagged | +Inquiry |
| Gmeb2-3245M | Recombinant Mouse Gmeb2 Protein, Myc/DDK-tagged | +Inquiry |
| GMEB2-2584R | Recombinant Rat GMEB2 Protein | +Inquiry |
| GMEB2-5407HF | Recombinant Full Length Human GMEB2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GMEB2 Products
Required fields are marked with *
My Review for All GMEB2 Products
Required fields are marked with *



