Cat.No.:	GMPR-5020H
Product Overview:	Human GMPR full-length ORF ( NP_006868.2, 1 a.a. - 345 a.a.) recombinant protein with GST-tag at N-terminal.
Description:	Guanosine monophosphate reductase (EC 1.7.1.7) catalyzes the irreversible NADPH-dependent reductive deamination of guanosine monophosphate (GMP) to inosine monophosphate (IMP). GMPR is able to convert guanosine nucleotides to the pivotal precursor of both guanine (G) and adenine (A) nucleotides. It plays an important role in maintaining the intracellular balance of A and G nucleotides.[supplied by OMIM
Source:	Wheat Germ
Species:	Human
Tag :	GST
Molecular Mass:	63.8 kDa
AA Sequence:	MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVIERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS
Applications:	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes:	Best use within three months from the date of receipt of this protein.
Storage:	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer:	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name:	GMPR guanosine monophosphate reductase [ Homo sapiens ]
Official Symbol:	GMPR
Synonyms:	GMPR; guanosine monophosphate reductase; GMP reductase 1; guanine monophosphate reductase; guanosine monophosphate reductase 1; guanosine 5-monophosphate oxidoreductase 1; GMPR1;
Gene ID:	2766
mRNA Refseq:	NM_006877
Protein Refseq:	NP_006868
MIM:	139265
UniProt ID:	P36959

Online Inquiry