Recombinant Human GMPR protein, His-SUMO-tagged
| Cat.No. : | GMPR-4033H |
| Product Overview : | Recombinant Human GMPR protein(P36959)(1-345aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-345aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 53.4 kDa |
| AA Sequence : | MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | GMPR guanosine monophosphate reductase [ Homo sapiens ] |
| Official Symbol | GMPR |
| Synonyms | GMPR; guanosine monophosphate reductase; GMP reductase 1; guanine monophosphate reductase; guanosine monophosphate reductase 1; guanosine 5-monophosphate oxidoreductase 1; GMPR1; |
| Gene ID | 2766 |
| mRNA Refseq | NM_006877 |
| Protein Refseq | NP_006868 |
| MIM | 139265 |
| UniProt ID | P36959 |
| ◆ Recombinant Proteins | ||
| GMPR-5020H | Recombinant Human GMPR Protein, GST-tagged | +Inquiry |
| GMPR-1491H | Recombinant Human GMPR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| GMPR-1926H | Recombinant Human Guanosine Monophosphate Reductase, His-tagged | +Inquiry |
| GMPR-2243R | Recombinant Rat GMPR Protein, His (Fc)-Avi-tagged | +Inquiry |
| GMPR-1598H | Recombinant Human GMPR protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GMPR-5877HCL | Recombinant Human GMPR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GMPR Products
Required fields are marked with *
My Review for All GMPR Products
Required fields are marked with *
