Recombinant Human GNB5, His-tagged
| Cat.No. : | GNB5-29091TH |
| Product Overview : | Recombinant full length protein, corresponding to amino acids 1-353 of Human GNB5 isoform 2, with a N terminal His tag; MWt 46kDa ; |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-353 a.a. |
| Description : | Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. Alternatively spliced transcript variants encoding different isoforms exist. |
| Conjugation : | HIS |
| Tissue specificity : | Expressed in multiple tissues. |
| Form : | Lyophilised:Reconstitution with 112 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MATEGLHENETLASLKSEAESLKGKLEEERAKLHDVELHQ VAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRI VSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPS GCAIACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYL SACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGH GADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCV QAFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRA DREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVW DVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHT LRVWA |
| Sequence Similarities : | Belongs to the WD repeat G protein beta family.Contains 7 WD repeats. |
| Full Length : | Full L. |
| Gene Name | GNB5 guanine nucleotide binding protein (G protein), beta 5 [ Homo sapiens ] |
| Official Symbol | GNB5 |
| Synonyms | GNB5; guanine nucleotide binding protein (G protein), beta 5; guanine nucleotide-binding protein subunit beta-5; GB5; |
| Gene ID | 10681 |
| mRNA Refseq | NM_006578 |
| Protein Refseq | NP_006569 |
| MIM | 604447 |
| Uniprot ID | O14775 |
| Chromosome Location | 15q21.1 |
| Pathway | ADP signalling through P2Y purinoceptor 1, organism-specific biosystem; ADP signalling through P2Y purinoceptor 12, organism-specific biosystem; Activation of Kainate Receptors upon glutamate binding, organism-specific biosystem; Aquaporin-mediated transport, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; |
| Function | GTPase activity; signal transducer activity; |
| ◆ Recombinant Proteins | ||
| GNB5-29091TH | Recombinant Human GNB5, His-tagged | +Inquiry |
| GNB5-7031M | Recombinant Mouse GNB5 Protein | +Inquiry |
| GNB5-2604R | Recombinant Rat GNB5 Protein | +Inquiry |
| GNB5-2259R | Recombinant Rat GNB5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GNB5-2978H | Recombinant Human GNB5 protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GNB5-5859HCL | Recombinant Human GNB5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNB5 Products
Required fields are marked with *
My Review for All GNB5 Products
Required fields are marked with *
