Recombinant Human GNG12 Protein, GST-tagged

Cat.No. : GNG12-5066H
Product Overview : Human GNG12 full-length ORF ( NP_061329.3, 1 a.a. - 72 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : GNG12 (G Protein Subunit Gamma 12) is a Protein Coding gene. Among its related pathways are Aquaporin-mediated transport and Immune response CCR3 signaling in eosinophils. GO annotations related to this gene include signal transducer activity and phosphate ion binding. An important paralog of this gene is GNG7.
Molecular Mass : 34.4 kDa
AA Sequence : MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTSENPFKDKKTCIIL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GNG12 guanine nucleotide binding protein (G protein), gamma 12 [ Homo sapiens ]
Official Symbol GNG12
Synonyms GNG12; guanine nucleotide binding protein (G protein), gamma 12; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12; G-protein gamma-12 subunit; FLJ31352; FLJ34695;
Gene ID 55970
mRNA Refseq NM_018841
Protein Refseq NP_061329
MIM 615405
UniProt ID Q9UBI6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GNG12 Products

Required fields are marked with *

My Review for All GNG12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon