Recombinant Human GNG2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | GNG2-5291H |
Product Overview : | GNG2 MS Standard C13 and N15-labeled recombinant protein (NP_444292) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes one of the gamma subunits of a guanine nucleotide-binding protein. Such proteins are involved in signaling mechanisms across membranes. Various subunits forms heterodimers which then interact with the different signal molecules. |
Molecular Mass : | 7.9 kDa |
AA Sequence : | MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAILTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | GNG2 G protein subunit gamma 2 [ Homo sapiens (human) ] |
Official Symbol | GNG2 |
Synonyms | GNG2; guanine nucleotide binding protein (G protein), gamma 2; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2; g gamma-I; guanine nucleotide binding protein gamma 2; guanine nucleotide-binding protein G(I)/G(O) gamma-2 subunit; |
Gene ID | 54331 |
mRNA Refseq | NM_053064 |
Protein Refseq | NP_444292 |
MIM | 606981 |
UniProt ID | P59768 |
◆ Recombinant Proteins | ||
GNG2-3773M | Recombinant Mouse GNG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNG2-5068H | Recombinant Human GNG2 Protein, GST-tagged | +Inquiry |
GNG2-1904R | Recombinant Rhesus monkey GNG2 Protein, His-tagged | +Inquiry |
GNG2-3864Z | Recombinant Zebrafish GNG2 | +Inquiry |
GNG2-13363H | Recombinant Human GNG2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNG2-5853HCL | Recombinant Human GNG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GNG2 Products
Required fields are marked with *
My Review for All GNG2 Products
Required fields are marked with *
0
Inquiry Basket