Recombinant Human GNG2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : GNG2-5291H
Product Overview : GNG2 MS Standard C13 and N15-labeled recombinant protein (NP_444292) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes one of the gamma subunits of a guanine nucleotide-binding protein. Such proteins are involved in signaling mechanisms across membranes. Various subunits forms heterodimers which then interact with the different signal molecules.
Molecular Mass : 7.9 kDa
AA Sequence : MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAILTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name GNG2 G protein subunit gamma 2 [ Homo sapiens (human) ]
Official Symbol GNG2
Synonyms GNG2; guanine nucleotide binding protein (G protein), gamma 2; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2; g gamma-I; guanine nucleotide binding protein gamma 2; guanine nucleotide-binding protein G(I)/G(O) gamma-2 subunit;
Gene ID 54331
mRNA Refseq NM_053064
Protein Refseq NP_444292
MIM 606981
UniProt ID P59768

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GNG2 Products

Required fields are marked with *

My Review for All GNG2 Products

Required fields are marked with *

0
cart-icon