Recombinant Human GNG7 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | GNG7-6287H |
| Product Overview : | GNG7 MS Standard C13 and N15-labeled recombinant protein (NP_443079) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Plays a role in the regulation of adenylyl cyclase signaling in certain regions of the brain. Plays a role in the formation or stabilzation of a G protein heterotrimer (G(olf) subunit alpha-beta-gamma-7) that is required for adenylyl cyclase activity in the striatum. |
| Molecular Mass : | 7.5 kDa |
| AA Sequence : | MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIILTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | GNG7 G protein subunit gamma 7 [ Homo sapiens (human) ] |
| Official Symbol | GNG7 |
| Synonyms | GNG7; guanine nucleotide binding protein (G protein), gamma 7; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7; FLJ00058; |
| Gene ID | 2788 |
| mRNA Refseq | NM_052847 |
| Protein Refseq | NP_443079 |
| MIM | 604430 |
| UniProt ID | O60262 |
| ◆ Recombinant Proteins | ||
| GNG7-1907R | Recombinant Rhesus monkey GNG7 Protein, His-tagged | +Inquiry |
| GNG7-2263R | Recombinant Rat GNG7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GNG7-28961TH | Recombinant Human GNG7 | +Inquiry |
| GNG7-534Z | Recombinant Zebrafish GNG7 | +Inquiry |
| GNG7-1727R | Recombinant Rhesus Macaque GNG7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GNG7-5850HCL | Recombinant Human GNG7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNG7 Products
Required fields are marked with *
My Review for All GNG7 Products
Required fields are marked with *
