Recombinant Human GNMT Protein, GST-tagged
| Cat.No. : | GNMT-5086H |
| Product Overview : | Human GNMT full-length ORF ( AAH32627, 1 a.a. - 295 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is an enzyme that catalyzes the conversion of S-adenosyl-L-methionine (along with glycine) to S-adenosyl-L-homocysteine and sarcosine. The encoded protein is found in the cytoplasm and acts as a homotetramer. Defects in this gene are a cause of GNMT deficiency (hypermethioninemia). [provided by RefSeq |
| Molecular Mass : | 58.19 kDa |
| AA Sequence : | MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHIVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHALKRTD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GNMT glycine N-methyltransferase [ Homo sapiens ] |
| Official Symbol | GNMT |
| Synonyms | GNMT; glycine N-methyltransferase; |
| Gene ID | 27232 |
| mRNA Refseq | NM_018960 |
| Protein Refseq | NP_061833 |
| MIM | 606628 |
| UniProt ID | Q14749 |
| ◆ Recombinant Proteins | ||
| GNMT-13373H | Recombinant Human GNMT, GST-tagged | +Inquiry |
| Gnmt-1041M | Recombinant Mouse Gnmt Protein, MYC/DDK-tagged | +Inquiry |
| GNMT-28152TH | Recombinant Human GNMT, His-tagged | +Inquiry |
| GNMT-29092TH | Recombinant Human GNMT, His-tagged | +Inquiry |
| GNMT-5400HF | Recombinant Full Length Human GNMT Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GNMT-5844HCL | Recombinant Human GNMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNMT Products
Required fields are marked with *
My Review for All GNMT Products
Required fields are marked with *
