Recombinant Human GNPAT protein, His-tagged
Cat.No. : | GNPAT-3350H |
Product Overview : | Recombinant Human GNPAT protein(331-680 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 331-680 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | PVSLRSLAAGRMSRSSYNLVPRYIPQKQSEDMHAFVTEVAYKMELLQIENMVLSPWTLIVAVLLQNRPSMDFDALVEKTLWLKGLTQAFGGFLIWPDNKPAEEVVPASILLHSNIASLVKDQVILKVDSGDSEVVDGLMLQHITLLMCSAYRNQLLNIFVRPSLVAVALQMTPGFRKEDVYSCFRFLRDVFADEFIFLPGNTLKDFEEGCYLLCKSEAIQVTTKDILVTEKGNTVLEFLVGLFKPFVESYQIICKHLLSEEEDHFSEEQYLAAVRKFTSQLLDQGTSQCYDVLSSDVQKNALAACVRLGVVEKKKINNNCIFNVNEPATTKLEEMLGCKTPIGKPATAKL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | GNPAT glyceronephosphate O-acyltransferase [ Homo sapiens ] |
Official Symbol | GNPAT |
Synonyms | GNPAT; glyceronephosphate O-acyltransferase; dihydroxyacetone phosphate acyltransferase; DAP AT; DAPAT; DHAPAT; DHAP-AT; glycerone-phosphate O-acyltransferase; acyl-CoA:dihydroxyacetonephosphateacyltransferase; DAP-AT; |
Gene ID | 8443 |
mRNA Refseq | NM_014236 |
Protein Refseq | NP_055051 |
MIM | 602744 |
UniProt ID | O15228 |
◆ Recombinant Proteins | ||
GNPAT-2268R | Recombinant Rat GNPAT Protein, His (Fc)-Avi-tagged | +Inquiry |
GNPAT-3350H | Recombinant Human GNPAT protein, His-tagged | +Inquiry |
GNPAT-7049M | Recombinant Mouse GNPAT Protein | +Inquiry |
GNPAT-639H | Recombinant Human GNPAT Protein, His-tagged | +Inquiry |
GNPAT-5088H | Recombinant Human GNPAT Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNPAT-5843HCL | Recombinant Human GNPAT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNPAT Products
Required fields are marked with *
My Review for All GNPAT Products
Required fields are marked with *
0
Inquiry Basket