Recombinant Human GNRH2, His-tagged
Cat.No. : | GNRH2-178H |
Product Overview : | Recombinant Human Progonadoliberin-2/GNRH2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln24-Val120) of Human GNRH2 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 24-120 a.a. |
AA Sequence : | QHWSHGWYPGGKRALSSAQDPQNALRPPGRALDTAAGSPVQTAHGLPSDALAPLDDSMPWEGRTT AQWSLHRKRHLARTLLTAAREPRPAPPSSNKVVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | GNRH2 gonadotropin-releasing hormone 2 [ Homo sapiens ] |
Official Symbol | GNRH2 |
Synonyms | GNRH2; gonadotropin-releasing hormone 2; progonadoliberin-2; luliberin II; progonadoliberin II; luteinizing hormone-releasing hormone II; GnRH-II; LH-RHII; |
Gene ID | 2797 |
mRNA Refseq | NM_001501 |
Protein Refseq | NP_001492 |
MIM | 602352 |
UniProt ID | O43555 |
Chromosome Location | 20p13 |
Pathway | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GnRH signaling pathway, organism-specific biosystem; GnRH signaling pathway, conserved biosystem; Hormone ligand-binding receptors, organism-specific biosystem; |
Function | hormone activity; |
◆ Recombinant Proteins | ||
GNRH2-178H | Recombinant Human GNRH2, His-tagged | +Inquiry |
GNRH2-9620Z | Recombinant Zebrafish GNRH2 | +Inquiry |
GNRH2-2979H | Recombinant Human GNRH2 Protein (Gln24-Val120), C-His tagged | +Inquiry |
GNRH2-1736R | Recombinant Rhesus Macaque GNRH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNRH2-5098H | Recombinant Human GNRH2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNRH2-5838HCL | Recombinant Human GNRH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GNRH2 Products
Required fields are marked with *
My Review for All GNRH2 Products
Required fields are marked with *
0
Inquiry Basket