Recombinant Human GNRH2, His-tagged
| Cat.No. : | GNRH2-178H |
| Product Overview : | Recombinant Human Progonadoliberin-2/GNRH2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln24-Val120) of Human GNRH2 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 24-120 a.a. |
| AA Sequence : | QHWSHGWYPGGKRALSSAQDPQNALRPPGRALDTAAGSPVQTAHGLPSDALAPLDDSMPWEGRTT AQWSLHRKRHLARTLLTAAREPRPAPPSSNKVVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Gene Name | GNRH2 gonadotropin-releasing hormone 2 [ Homo sapiens ] |
| Official Symbol | GNRH2 |
| Synonyms | GNRH2; gonadotropin-releasing hormone 2; progonadoliberin-2; luliberin II; progonadoliberin II; luteinizing hormone-releasing hormone II; GnRH-II; LH-RHII; |
| Gene ID | 2797 |
| mRNA Refseq | NM_001501 |
| Protein Refseq | NP_001492 |
| MIM | 602352 |
| UniProt ID | O43555 |
| Chromosome Location | 20p13 |
| Pathway | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GnRH signaling pathway, organism-specific biosystem; GnRH signaling pathway, conserved biosystem; Hormone ligand-binding receptors, organism-specific biosystem; |
| Function | hormone activity; |
| ◆ Recombinant Proteins | ||
| GNRH2-33HFL | Recombinant Human Full Length GNRH2 Protein, Flag tagged | +Inquiry |
| GNRH2-2979H | Recombinant Human GNRH2 Protein (Gln24-Val120), C-His tagged | +Inquiry |
| GNRH2-5410HF | Recombinant Full Length Human GNRH2 Protein, GST-tagged | +Inquiry |
| GNRH2-1916R | Recombinant Rhesus monkey GNRH2 Protein, His-tagged | +Inquiry |
| GNRH2-5744H | Recombinant Human GNRH2 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GNRH2-5838HCL | Recombinant Human GNRH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNRH2 Products
Required fields are marked with *
My Review for All GNRH2 Products
Required fields are marked with *
