Recombinant Human GNRHR Protein
| Cat.No. : | GNRHR-5099H |
| Product Overview : | Human GNRHR full-length ORF (ADR83139.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | This gene encodes the receptor for type 1 gonadotropin-releasing hormone. This receptor is a member of the seven-transmembrane, G-protein coupled receptor (GPCR) family. It is expressed on the surface of pituitary gonadotrope cells as well as lymphocytes, breast, ovary, and prostate. Following binding of gonadotropin-releasing hormone, the receptor associates with G-proteins that activate a phosphatidylinositol-calcium second messenger system. Activation of the receptor ultimately causes the release of gonadotropic luteinizing hormone (LH) and follicle stimulating hormone (FSH). Defects in this gene are a cause of hypogonadotropic hypogonadism (HH). Alternative splicing results in multiple transcript variants encoding different isoforms. More than 18 transcription initiation sites in the 5 region and multiple polyA signals in the 3 region have been identified for this gene. [provided by RefSeq |
| Form : | Liquid |
| Molecular Mass : | 36.1 kDa |
| AA Sequence : | MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL |
| Applications : | Antibody Production Functional Study Compound Screening |
| Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | GNRHR gonadotropin-releasing hormone receptor [ Homo sapiens ] |
| Official Symbol | GNRHR |
| Synonyms | GNRHR; gonadotropin-releasing hormone receptor; GRHR; LHRHR; gnRH-R; gnRH receptor; luliberin receptor; type I GnRH receptor; leutinizing-releasing hormone receptor; leutinizing hormone releasing horomone receptor; gonadotropin-releasing hormone (type 1) receptor 1; LRHR; GNRHR1; |
| Gene ID | 2798 |
| mRNA Refseq | NM_000406 |
| Protein Refseq | NP_000397 |
| MIM | 138850 |
| UniProt ID | P30968 |
| ◆ Recombinant Proteins | ||
| GNRHR-1979C | Recombinant Chicken GNRHR | +Inquiry |
| GNRHR-1044HFL | Recombinant Human GNRHR protein, His&Flag-tagged | +Inquiry |
| RFL27010BF | Recombinant Full Length Bovine Gonadotropin-Releasing Hormone Receptor(Gnrhr) Protein, His-Tagged | +Inquiry |
| GNRHR-5099H | Recombinant Human GNRHR Protein | +Inquiry |
| RFL21244EF | Recombinant Full Length Horse Gonadotropin-Releasing Hormone Receptor(Gnrhr) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GNRHR-5837HCL | Recombinant Human GNRHR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNRHR Products
Required fields are marked with *
My Review for All GNRHR Products
Required fields are marked with *
