Recombinant Human GOLGA5 Protein, His-tagged

Cat.No. : GOLGA5-50H
Product Overview : Recombinant Human GOLGA5 Protein(251-410 aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 251-410 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AASequence : RSKETQEELNKARARVEKWNADHSKSDRMTRGLRAQVDDLTEAVAAKDSQLAVLKVRLQEADQLLSTRTEALEALQSEKSRIMQDQSEGNSLQNQALQTLQERLHEADATLKREQESYKQMQSEFAARLNKVEMERQNLAEAITLAERKYSDEKKRVDEL
Purity : 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 12 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
Gene Name GOLGA5 golgin A5 [ Homo sapiens ]
Official Symbol GOLGA5
Synonyms GOLGA5; golgin A5; golgi autoantigen, golgin subfamily a, 5; Golgin subfamily A member 5; golgi integral membrane protein 5; golgin 84; GOLIM5; ret II; rfg5; golgin-84; RET-fused gene 5 protein; cell proliferation-inducing gene 31 protein; RFG5; ret-II;
Gene ID 9950
mRNA Refseq NM_005113
Protein Refseq NP_005104
MIM 606918
UniProt ID Q8TBA6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GOLGA5 Products

Required fields are marked with *

My Review for All GOLGA5 Products

Required fields are marked with *

0
cart-icon
0
compare icon