Recombinant Human GOLGA5 Protein, His-tagged

• Cat.No.: GOLGA5-50H
• Product Overview: Recombinant Human GOLGA5 Protein(251-410 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 251-410 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AASequence: RSKETQEELNKARARVEKWNADHSKSDRMTRGLRAQVDDLTEAVAAKDSQLAVLKVRLQEADQLLSTRTEALEALQSEKSRIMQDQSEGNSLQNQALQTLQERLHEADATLKREQESYKQMQSEFAARLNKVEMERQNLAEAITLAERKYSDEKKRVDEL
• Purity: 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 12 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: GOLGA5 golgin A5 [ Homo sapiens ]
• Official Symbol: GOLGA5
• Synonyms: GOLGA5; golgin A5; golgi autoantigen, golgin subfamily a, 5; Golgin subfamily A member 5; golgi integral membrane protein 5; golgin 84; GOLIM5; ret II; rfg5; golgin-84; RET-fused gene 5 protein; cell proliferation-inducing gene 31 protein; RFG5; ret-II
• Gene ID: 9950
• mRNA Refseq: NM_005113
• Protein Refseq: NP_005104
• MIM: 606918
• UniProt ID: Q8TBA6