Recombinant Human GOLGA7 Protein, GST-tagged

Cat.No. : GOLGA7-5110H
Product Overview : Human GOLGA7 full-length ORF ( AAH12032, 1 a.a. - 137 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : GOLGA7 (Golgin A7) is a Protein Coding gene. Among its related pathways are Innate Immune System. An important paralog of this gene is GOLGA7B.
Molecular Mass : 40.81 kDa
AA Sequence : MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GOLGA7 golgin A7 [ Homo sapiens ]
Official Symbol GOLGA7
Synonyms GOLGA7; golgin A7; golgi autoantigen, golgin subfamily a, 7; Golgin subfamily A member 7; GCP16; GOLGA3AP1; GOLGA7A; HSPC041; Golgi complex-associated protein of 16kDa; golgi complex-associated protein of 16 kDa; MGC4876; MGC21096;
Gene ID 51125
mRNA Refseq NM_001002296
Protein Refseq NP_001002296
MIM 609453
UniProt ID Q7Z5G4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GOLGA7 Products

Required fields are marked with *

My Review for All GOLGA7 Products

Required fields are marked with *

0
cart-icon