Recombinant Human GOLGA7 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : GOLGA7-4125H
Product Overview : GOLGA7 MS Standard C13 and N15-labeled recombinant protein (NP_001002296) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : GOLGA7 (Golgin A7) is a Protein Coding gene. Diseases associated with GOLGA7 include Thymic Dysplasia. Among its related pathways are Innate Immune System. An important paralog of this gene is GOLGA7B.
Molecular Mass : 15.8 kDa
AA Sequence : MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name GOLGA7 golgin A7 [ Homo sapiens (human) ]
Official Symbol GOLGA7
Synonyms GOLGA7; golgin A7; golgi autoantigen, golgin subfamily a, 7; Golgin subfamily A member 7; GCP16; GOLGA3AP1; GOLGA7A; HSPC041; Golgi complex-associated protein of 16kDa; golgi complex-associated protein of 16 kDa; MGC4876; MGC21096;
Gene ID 51125
mRNA Refseq NM_001002296
Protein Refseq NP_001002296
MIM 609453
UniProt ID Q7Z5G4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GOLGA7 Products

Required fields are marked with *

My Review for All GOLGA7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon