Recombinant Human GOLGA7 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: GOLGA7-4125H
• Product Overview: GOLGA7 MS Standard C13 and N15-labeled recombinant protein (NP_001002296) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: GOLGA7 (Golgin A7) is a Protein Coding gene. Diseases associated with GOLGA7 include Thymic Dysplasia. Among its related pathways are Innate Immune System. An important paralog of this gene is GOLGA7B.
• Molecular Mass: 15.8 kDa
• AA Sequence: MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: GOLGA7 golgin A7 [ Homo sapiens (human) ]
• Official Symbol: GOLGA7
• Synonyms: GOLGA7; golgin A7; golgi autoantigen, golgin subfamily a, 7; Golgin subfamily A member 7; GCP16; GOLGA3AP1; GOLGA7A; HSPC041; Golgi complex-associated protein of 16kDa; golgi complex-associated protein of 16 kDa; MGC4876; MGC21096
• Gene ID: 51125
• mRNA Refseq: NM_001002296
• Protein Refseq: NP_001002296
• MIM: 609453
• UniProt ID: Q7Z5G4