Recombinant Human GOLGA7 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | GOLGA7-4125H |
| Product Overview : | GOLGA7 MS Standard C13 and N15-labeled recombinant protein (NP_001002296) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | GOLGA7 (Golgin A7) is a Protein Coding gene. Diseases associated with GOLGA7 include Thymic Dysplasia. Among its related pathways are Innate Immune System. An important paralog of this gene is GOLGA7B. |
| Molecular Mass : | 15.8 kDa |
| AA Sequence : | MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | GOLGA7 golgin A7 [ Homo sapiens (human) ] |
| Official Symbol | GOLGA7 |
| Synonyms | GOLGA7; golgin A7; golgi autoantigen, golgin subfamily a, 7; Golgin subfamily A member 7; GCP16; GOLGA3AP1; GOLGA7A; HSPC041; Golgi complex-associated protein of 16kDa; golgi complex-associated protein of 16 kDa; MGC4876; MGC21096; |
| Gene ID | 51125 |
| mRNA Refseq | NM_001002296 |
| Protein Refseq | NP_001002296 |
| MIM | 609453 |
| UniProt ID | Q7Z5G4 |
| ◆ Recombinant Proteins | ||
| GOLGA7-1739R | Recombinant Rhesus Macaque GOLGA7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GOLGA7-2272R | Recombinant Rat GOLGA7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GOLGA7-13386H | Recombinant Human GOLGA7, GST-tagged | +Inquiry |
| GOLGA7-558H | Recombinant Human golgin A7, His-tagged | +Inquiry |
| GOLGA7-1919R | Recombinant Rhesus monkey GOLGA7 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GOLGA7-5834HCL | Recombinant Human GOLGA7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GOLGA7 Products
Required fields are marked with *
My Review for All GOLGA7 Products
Required fields are marked with *
