Recombinant Human GOLIM4 protein, His-tagged
Cat.No. : | GOLIM4-7856H |
Product Overview : | Recombinant Human GOLIM4 protein(350-500 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 350-500 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | QVGQAEHLEEEHDPSPEEQDREWKEQHEQREAANLLEGHARAEVYPSAKPMIKFQSPYEEQLEQQRLAVQQVEEAQQLREHQEALHQQRLQGHLLRQQEQQQQQVAREMALQRQAELEEGRPQHQEQLRQQAHYDAMDNDIVQGAEDQGIQ |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | GOLIM4 golgi integral membrane protein 4 [ Homo sapiens ] |
Official Symbol | GOLIM4 |
Synonyms | GOLIM4; golgi integral membrane protein 4; golgi phosphoprotein 4 , GOLPH4; Golgi integral membrane protein 4; GIMPC; GPP130; P138; golgi phosphoprotein 4; type II Golgi membrane protein; golgi phosphoprotein of 130 kDa; golgi integral membrane protein, cis; 130 kDa golgi-localized phosphoprotein; golgi-localized phosphoprotein of 130 kDa; cis Golgi-localized calcium-binding protein; GOLPH4; |
mRNA Refseq | NM_014498 |
Protein Refseq | NP_055313 |
MIM | 606805 |
UniProt ID | O00461 |
Gene ID | 27333 |
◆ Recombinant Proteins | ||
GOLIM4-3795M | Recombinant Mouse GOLIM4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL31237HF | Recombinant Full Length Human Golgi Integral Membrane Protein 4(Golim4) Protein, His-Tagged | +Inquiry |
GOLIM4-7856H | Recombinant Human GOLIM4 protein, His-tagged | +Inquiry |
GOLIM4-7066M | Recombinant Mouse GOLIM4 Protein | +Inquiry |
GOLIM4-7855H | Recombinant Human GOLIM4 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GOLIM4 Products
Required fields are marked with *
My Review for All GOLIM4 Products
Required fields are marked with *
0
Inquiry Basket