Recombinant Human GOLM1 protein
Cat.No. : | GOLM1-2981H |
Product Overview : | Recombinant Human GOLM1 protein(Q8NBJ4)(36-401aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 36-401aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 41.6 kDa |
AA Sequence : | SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GOLM1 golgi membrane protein 1 [ Homo sapiens ] |
Official Symbol | GOLM1 |
Synonyms | GOLM1; golgi membrane protein 1; C9orf155, chromosome 9 open reading frame 155 , golgi phosphoprotein 2 , GOLPH2; Golgi membrane protein 1; bA379P1.3; FLJ23608; GP73; golgi protein, 73-kD; golgi phosphoprotein 2; golgi membrane protein GP73; GOLPH2; C9orf155; PSEC0257; FLJ22634; |
Gene ID | 51280 |
mRNA Refseq | NM_016548 |
Protein Refseq | NP_057632 |
MIM | 606804 |
UniProt ID | Q8NBJ4 |
◆ Recombinant Proteins | ||
GOLM1-6943H | Recombinant Human GOLM1, His tagged | +Inquiry |
GOLM1-4824H | Recombinant Human GOLM1 Protein (Val40-Leu401), C-His tagged | +Inquiry |
GOLM1-1781H | Recombinant Human GOLM1 protein, His & GST-tagged | +Inquiry |
Golm1-2982M | Recombinant Mouse Golm1 protein, His-SUMO-tagged | +Inquiry |
GOLM1-3544H | Recombinant Human GOLM1 Protein (Ser35-Leu400), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GOLM1-1856HCL | Recombinant Human GOLM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GOLM1 Products
Required fields are marked with *
My Review for All GOLM1 Products
Required fields are marked with *
0
Inquiry Basket