Recombinant Human GOLM1 protein, GST-tagged

Cat.No. : GOLM1-2980H
Product Overview : Recombinant Human GOLM1 protein(Q8NBJ4)(36-401aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 36-401aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 68.6 kDa
AA Sequence : SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name GOLM1 golgi membrane protein 1 [ Homo sapiens ]
Official Symbol GOLM1
Synonyms GOLM1; golgi membrane protein 1; C9orf155, chromosome 9 open reading frame 155 , golgi phosphoprotein 2 , GOLPH2; Golgi membrane protein 1; bA379P1.3; FLJ23608; GP73; golgi protein, 73-kD; golgi phosphoprotein 2; golgi membrane protein GP73; GOLPH2; C9orf155; PSEC0257; FLJ22634;
Gene ID 51280
mRNA Refseq NM_016548
Protein Refseq NP_057632
MIM 606804
UniProt ID Q8NBJ4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GOLM1 Products

Required fields are marked with *

My Review for All GOLM1 Products

Required fields are marked with *

0
cart-icon