Recombinant Human GON7 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: GON7-501H
• Product Overview: C14orf142 MS Standard C13 and N15-labeled recombinant protein (NP_115879) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t6A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. GON7 likely plays a supporting role to the catalytic subunit OSGEP in the complex.
• Molecular Mass: 10.9 kDa
• AA Sequence: MELLGEYVGQEGKPQKLRVSCEAPGDGDPFQGLLSGVAQMKDMVTELFDPLVQGEVQHRVAAAPDEDLDGDDEDDAEDENNIDNRTNFDGPSAKRPKTPSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: GON7 GON7 subunit of KEOPS complex [ Homo sapiens (human) ]
• Official Symbol: GON7
• Synonyms: GON7; GON7 subunit of KEOPS complex; PNAS-127; C14orf142; EKC/KEOPS complex subunit GON7; GON7, KEOPS complex subunit homolog; uncharacterized protein C14orf142
• Gene ID: 84520
• mRNA Refseq: NM_032490
• Protein Refseq: NP_115879
• MIM: 617436
• UniProt ID: Q9BXV9