Recombinant Human GOSR2 protein, His-tagged
Cat.No. : | GOSR2-7568H |
Product Overview : | Recombinant Human GOSR2 protein(NP_001012529)(1-192 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-192 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYF |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | GOSR2 golgi SNAP receptor complex member 2 [ Homo sapiens ] |
Official Symbol | GOSR2 |
Synonyms | GOSR2; golgi SNAP receptor complex member 2; Golgi SNAP receptor complex member 2; Bos1; GS27; membrin; 27 kDa Golgi SNARE protein; EPM6; |
Gene ID | 9570 |
mRNA Refseq | NM_001012511 |
Protein Refseq | NP_001012529 |
MIM | 604027 |
UniProt ID | O14653 |
◆ Cell & Tissue Lysates | ||
GOSR2-5826HCL | Recombinant Human GOSR2 293 Cell Lysate | +Inquiry |
GOSR2-5825HCL | Recombinant Human GOSR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GOSR2 Products
Required fields are marked with *
My Review for All GOSR2 Products
Required fields are marked with *