Recombinant Human GPBAR1 protein, GST-tagged
Cat.No. : | GPBAR1-10H |
Product Overview : | Recombinant Human GPBAR1(1 a.a. - 330 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1 a.a. - 330 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 62.04 kDa |
AA Sequence : | MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLW NQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWT PGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARA QAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQ GLWGRASRDSPGPSIAYHPSSQSSVDLDLN |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | GPBAR1 G protein-coupled bile acid receptor 1 [ Homo sapiens ] |
Official Symbol | GPBAR1 |
Synonyms | BG37; TGR5; M-BAR; GPCR19; GPR131 |
Gene ID | 151306 |
mRNA Refseq | NM_170699.2 |
Protein Refseq | NP_733800.1 |
MIM | 610147 |
UniProt ID | Q8TDU6 |
Chromosome Location | 2q35 |
Pathway | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem;G alpha (s) signalling events, organism-specific biosystem;GPCR downstream signaling, organism-specific biosystem;GPCR ligand binding, organism-specific biosystem;Signal Transduction, organism-specific biosystem;Signaling by GPCR, organism-specific biosystem; |
Function | G-protein coupled receptor activity; |
◆ Recombinant Proteins | ||
GPBAR1-6874H | Recombinant Human GPBAR1 protein, His-KSI-tagged | +Inquiry |
GPBAR1-1041HFL | Recombinant Human GPBAR1 protein, His&Flag-tagged | +Inquiry |
RFL14048MF | Recombinant Full Length Mouse G-Protein Coupled Bile Acid Receptor 1(Gpbar1) Protein, His-Tagged | +Inquiry |
GPBAR1-1928R | Recombinant Rhesus monkey GPBAR1 Protein, His-tagged | +Inquiry |
GPBAR1-10H | Recombinant Human GPBAR1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPBAR1-5814HCL | Recombinant Human GPBAR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPBAR1 Products
Required fields are marked with *
My Review for All GPBAR1 Products
Required fields are marked with *