"GPBAR1" Related Products

Expand
Expand

Recombinant Human GPBAR1 protein, GST-tagged

Cat.No.: GPBAR1-10H
Product Overview: Recombinant Human GPBAR1(1 a.a. - 330 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 62.04 kDa
Protein length: 1 a.a. - 330 a.a.
AA Sequence: MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLW NQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWT PGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARA QAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQ GLWGRASRDSPGPSIAYHPSSQSSVDLDLN
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: GPBAR1 G protein-coupled bile acid receptor 1 [ Homo sapiens ]
Official Symbol: GPBAR1
Synonyms: BG37; TGR5; M-BAR; GPCR19; GPR131
Gene ID: 151306
mRNA Refseq: NM_170699.2
Protein Refseq: NP_733800.1
MIM: 610147
UniProt ID: Q8TDU6
Chromosome Location: 2q35
Pathway: Class A/1 (Rhodopsin-like receptors), organism-specific biosystem;G alpha (s) signalling events, organism-specific biosystem;GPCR downstream signaling, organism-specific biosystem;GPCR ligand binding, organism-specific biosystem;Signal Transduction, organism-specific biosystem;Signaling by GPCR, organism-specific biosystem;
Function: G-protein coupled receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.