Recombinant Human GPD1 protein, His-tagged

Cat.No. : GPD1-17H
Product Overview : Recombinant Human GPD1(Met1-Met349) fused with His tag at C-terminal was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 1-349 a.a.
Description : Glycerol-3-Phosphate Dehydrogenase [NAD(+)], Cytoplasmic (GPDH-C) belongs to the NAD-Dependent Glycerol-3-Phosphate Dehydrogenase family. GPDH-C plays a critical role in carbohydrate and lipid metabolism by catalyzing the reversible conversion of Dihydroxyacetone Phosphate (DHAP) and reducing Nicotine Adenine Dinucleotide (NADH) to Glycerol-3-Phosphate (G3P) and NAD+. GPDH-C is inhibited by zinc ions and sulfate. Mutations in this gene are a cause of transient infantile hypertriglyceridemia. GPDH-C is unlike Glyceraldehyde 3-Phosphate Dehydrogenase (GAPDH); they have different substrates.
Form : Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 10% Glycerol, pH 8.0.
AA Sequence : MASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKLTEIINTQHENVKYLP GHKLPPNVVAVPDVVQAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIKGVDEGPNGLK LISEVIGERLGIPMSVLMGANIASEVADEKFCETTIGCKDPAQGQLLKELMQTPNFRITVVQEVD TVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLFCSGPVSSATFLESCGVAD LITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGPETARELYSILQHKGLVDKFPLFMAV YKVCYEGQPVGEFIHCLQNHPEHMVDHHHHHH
Endotoxin : Less than 0.1 ng/µg (1 EU/µg) as determined by LAL test.
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Storage : Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
Gene Name GPD1 glycerol-3-phosphate dehydrogenase 1 (soluble) [ Homo sapiens ]
Official Symbol GPD1
Synonyms GPD1; glycerol-3-phosphate dehydrogenase 1 (soluble); glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic; glycerophosphate dehydrogenase; glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; GPD-C; HTGTI; GPDH-C; FLJ26652;
Gene ID 2819
mRNA Refseq NM_001257199
Protein Refseq NP_001244128
MIM 138420
UniProt ID P21695
Chromosome Location 12q13.12
Pathway Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Glycerophospholipid metabolism, organism-specific biosystem; Glycerophospholipid metabolism, conserved biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Triacylglyceride Synthesis, organism-specific biosystem; Triglyceride Biosynthesis, organism-specific biosystem;
Function NAD binding; glycerol-3-phosphate dehydrogenase [NAD+] activity; glycerol-3-phosphate dehydrogenase activity; protein homodimerization activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPD1 Products

Required fields are marked with *

My Review for All GPD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon