Recombinant Human GPD1 protein, His-tagged

• Cat.No.: GPD1-17H
• Product Overview: Recombinant Human GPD1(Met1-Met349) fused with His tag at C-terminal was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 1-349 a.a.
• Description: Glycerol-3-Phosphate Dehydrogenase [NAD(+)], Cytoplasmic (GPDH-C) belongs to the NAD-Dependent Glycerol-3-Phosphate Dehydrogenase family. GPDH-C plays a critical role in carbohydrate and lipid metabolism by catalyzing the reversible conversion of Dihydroxyacetone Phosphate (DHAP) and reducing Nicotine Adenine Dinucleotide (NADH) to Glycerol-3-Phosphate (G3P) and NAD+. GPDH-C is inhibited by zinc ions and sulfate. Mutations in this gene are a cause of transient infantile hypertriglyceridemia. GPDH-C is unlike Glyceraldehyde 3-Phosphate Dehydrogenase (GAPDH); they have different substrates.
• Form: Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 10% Glycerol, pH 8.0.
• AA Sequence: MASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKLTEIINTQHENVKYLP GHKLPPNVVAVPDVVQAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIKGVDEGPNGLK LISEVIGERLGIPMSVLMGANIASEVADEKFCETTIGCKDPAQGQLLKELMQTPNFRITVVQEVD TVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLFCSGPVSSATFLESCGVAD LITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGPETARELYSILQHKGLVDKFPLFMAV YKVCYEGQPVGEFIHCLQNHPEHMVDHHHHHH
• Endotoxin: Less than 0.1 ng/µg (1 EU/µg) as determined by LAL test.
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Storage: Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles.

Gene Information

• Gene Name: GPD1 glycerol-3-phosphate dehydrogenase 1 (soluble) [ Homo sapiens ]
• Official Symbol: GPD1
• Synonyms: GPD1; glycerol-3-phosphate dehydrogenase 1 (soluble); glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic; glycerophosphate dehydrogenase; glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; GPD-C; HTGTI; GPDH-C; FLJ26652
• Gene ID: 2819
• mRNA Refseq: NM_001257199
• Protein Refseq: NP_001244128
• MIM: 138420
• UniProt ID: P21695
• Chromosome Location: 12q13.12
• Pathway: Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Glycerophospholipid metabolism, organism-specific biosystem; Glycerophospholipid metabolism, conserved biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Triacylglyceride Synthesis, organism-specific biosystem; Triglyceride Biosynthesis, organism-specific biosystem
• Function: NAD binding; glycerol-3-phosphate dehydrogenase [NAD+] activity; glycerol-3-phosphate dehydrogenase activity; protein homodimerization activity