Recombinant Human GPD1 protein, His-tagged
| Cat.No. : | GPD1-17H |
| Product Overview : | Recombinant Human GPD1(Met1-Met349) fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 1-349 a.a. |
| Description : | Glycerol-3-Phosphate Dehydrogenase [NAD(+)], Cytoplasmic (GPDH-C) belongs to the NAD-Dependent Glycerol-3-Phosphate Dehydrogenase family. GPDH-C plays a critical role in carbohydrate and lipid metabolism by catalyzing the reversible conversion of Dihydroxyacetone Phosphate (DHAP) and reducing Nicotine Adenine Dinucleotide (NADH) to Glycerol-3-Phosphate (G3P) and NAD+. GPDH-C is inhibited by zinc ions and sulfate. Mutations in this gene are a cause of transient infantile hypertriglyceridemia. GPDH-C is unlike Glyceraldehyde 3-Phosphate Dehydrogenase (GAPDH); they have different substrates. |
| Form : | Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 10% Glycerol, pH 8.0. |
| AA Sequence : | MASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKLTEIINTQHENVKYLP GHKLPPNVVAVPDVVQAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIKGVDEGPNGLK LISEVIGERLGIPMSVLMGANIASEVADEKFCETTIGCKDPAQGQLLKELMQTPNFRITVVQEVD TVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLFCSGPVSSATFLESCGVAD LITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGPETARELYSILQHKGLVDKFPLFMAV YKVCYEGQPVGEFIHCLQNHPEHMVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/µg (1 EU/µg) as determined by LAL test. |
| Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
| Storage : | Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles. |
| Gene Name | GPD1 glycerol-3-phosphate dehydrogenase 1 (soluble) [ Homo sapiens ] |
| Official Symbol | GPD1 |
| Synonyms | GPD1; glycerol-3-phosphate dehydrogenase 1 (soluble); glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic; glycerophosphate dehydrogenase; glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; GPD-C; HTGTI; GPDH-C; FLJ26652; |
| Gene ID | 2819 |
| mRNA Refseq | NM_001257199 |
| Protein Refseq | NP_001244128 |
| MIM | 138420 |
| UniProt ID | P21695 |
| Chromosome Location | 12q13.12 |
| Pathway | Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Glycerophospholipid metabolism, organism-specific biosystem; Glycerophospholipid metabolism, conserved biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Triacylglyceride Synthesis, organism-specific biosystem; Triglyceride Biosynthesis, organism-specific biosystem; |
| Function | NAD binding; glycerol-3-phosphate dehydrogenase [NAD+] activity; glycerol-3-phosphate dehydrogenase activity; protein homodimerization activity; |
| ◆ Recombinant Proteins | ||
| GPD1-8785H | Recombinant Human GPD1 protein, His-tagged | +Inquiry |
| GPD1-2440H | Recombinant Human GPD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| GPD1-2289R | Recombinant Rat GPD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GPD1-281H | Recombinant Human GPD1 protein(Met1-Met349), His-tagged | +Inquiry |
| GPD1-2962H | Recombinant Human GPD1 Protein (Met1-Met349), C-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GPD1-5809HCL | Recombinant Human GPD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPD1 Products
Required fields are marked with *
My Review for All GPD1 Products
Required fields are marked with *
