Recombinant Human GPHN Protein, GST-tagged

Cat.No. : GPHN-5155H
Product Overview : Human GPHN partial ORF ( NP_065857, 677 a.a. - 769 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a neuronal assembly protein that anchors inhibitory neurotransmitter receptors to the postsynaptic cytoskeleton via high affinity binding to a receptor subunit domain and tubulin dimers. In nonneuronal tissues, the encoded protein is also required for molybdenum cofactor biosynthesis. Mutations in this gene may be associated with the neurological condition hyperplexia and also lead to molybdenum cofactor deficiency. Numerous alternatively spliced transcript variants encoding different isoforms have been described; however, the full-length nature of all transcript variants is not currently known. [provided by RefSeq
Molecular Mass : 35.97 kDa
AA Sequence : RKMQGILDPRPTIIKARLSCDVKLDPRPEYHRCILTWHHQEPLPWAQSTGNQMSSRLMSMRSANGLLMLPPKTEQYVELHKGEVVDVMVIGRL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GPHN gephyrin [ Homo sapiens ]
Official Symbol GPHN
Synonyms GPHN; gephyrin; KIAA1385; GPH; GEPH; GPHRYN;
Gene ID 10243
mRNA Refseq NM_001024218
Protein Refseq NP_001019389
MIM 603930
UniProt ID Q9NQX3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPHN Products

Required fields are marked with *

My Review for All GPHN Products

Required fields are marked with *

0
cart-icon