Recombinant Human GPHN Protein, GST-tagged
Cat.No. : | GPHN-5155H |
Product Overview : | Human GPHN partial ORF ( NP_065857, 677 a.a. - 769 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a neuronal assembly protein that anchors inhibitory neurotransmitter receptors to the postsynaptic cytoskeleton via high affinity binding to a receptor subunit domain and tubulin dimers. In nonneuronal tissues, the encoded protein is also required for molybdenum cofactor biosynthesis. Mutations in this gene may be associated with the neurological condition hyperplexia and also lead to molybdenum cofactor deficiency. Numerous alternatively spliced transcript variants encoding different isoforms have been described; however, the full-length nature of all transcript variants is not currently known. [provided by RefSeq |
Molecular Mass : | 35.97 kDa |
AA Sequence : | RKMQGILDPRPTIIKARLSCDVKLDPRPEYHRCILTWHHQEPLPWAQSTGNQMSSRLMSMRSANGLLMLPPKTEQYVELHKGEVVDVMVIGRL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GPHN gephyrin [ Homo sapiens ] |
Official Symbol | GPHN |
Synonyms | GPHN; gephyrin; KIAA1385; GPH; GEPH; GPHRYN; |
Gene ID | 10243 |
mRNA Refseq | NM_001024218 |
Protein Refseq | NP_001019389 |
MIM | 603930 |
UniProt ID | Q9NQX3 |
◆ Recombinant Proteins | ||
GPHN-1009H | Recombinant Human GPHN Protein, His (Fc)-Avi-tagged | +Inquiry |
Gphn-3288M | Recombinant Mouse Gphn Protein, Myc/DDK-tagged | +Inquiry |
GPHN-1754R | Recombinant Rhesus Macaque GPHN Protein, His (Fc)-Avi-tagged | +Inquiry |
GPHN-2293R | Recombinant Rat GPHN Protein, His (Fc)-Avi-tagged | +Inquiry |
GPHN-2749H | Recombinant Human GPHN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPHN-5807HCL | Recombinant Human GPHN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPHN Products
Required fields are marked with *
My Review for All GPHN Products
Required fields are marked with *