Recombinant Human GPHN Protein, GST-tagged
| Cat.No. : | GPHN-5155H |
| Product Overview : | Human GPHN partial ORF ( NP_065857, 677 a.a. - 769 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 677-769 aa |
| Description : | This gene encodes a neuronal assembly protein that anchors inhibitory neurotransmitter receptors to the postsynaptic cytoskeleton via high affinity binding to a receptor subunit domain and tubulin dimers. In nonneuronal tissues, the encoded protein is also required for molybdenum cofactor biosynthesis. Mutations in this gene may be associated with the neurological condition hyperplexia and also lead to molybdenum cofactor deficiency. Numerous alternatively spliced transcript variants encoding different isoforms have been described; however, the full-length nature of all transcript variants is not currently known. [provided by RefSeq |
| Molecular Mass : | 35.97 kDa |
| AA Sequence : | RKMQGILDPRPTIIKARLSCDVKLDPRPEYHRCILTWHHQEPLPWAQSTGNQMSSRLMSMRSANGLLMLPPKTEQYVELHKGEVVDVMVIGRL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GPHN gephyrin [ Homo sapiens ] |
| Official Symbol | GPHN |
| Synonyms | GPHN; gephyrin; KIAA1385; GPH; GEPH; GPHRYN; |
| Gene ID | 10243 |
| mRNA Refseq | NM_001024218 |
| Protein Refseq | NP_001019389 |
| MIM | 603930 |
| UniProt ID | Q9NQX3 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPHN Products
Required fields are marked with *
My Review for All GPHN Products
Required fields are marked with *
