Recombinant Human GPN2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | GPN2-5565H |
Product Overview : | GPN2 MS Standard C13 and N15-labeled recombinant protein (NP_060536) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | GPN2 (GPN-Loop GTPase 2) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include nucleotide binding and hydrolase activity. An important paralog of this gene is GPN3. |
Molecular Mass : | 34.5 kDa |
AA Sequence : | MAGAAPTTAFGQAVIGPPGSGKTTYCLGMSEFLRALGRRVAVVNLDPANEGLPYECAVDVGELVGLGDVMDALRLGPNGGLLYCMEYLEANLDWLRAKLDPLRGHYFLFDCPGQVELCTHHGALRSIFSQMAQWDLRLTAVHLVDSHYCTDPAKFISVLCTSLATMLHVELPHINLLSKMDLIEHYGKLAFNLDYYTEVLDLSYLLDHLASDPFFRHYRQLNEKLVRLIEDYSLVSFIPLNIQDKESIQRVLQAVDKANGYCFGAQEQRSLEAMMSAAMGADFHFSSTLGIQEKYLAPSNQSVEQEAMQLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | GPN2 GPN-loop GTPase 2 [ Homo sapiens (human) ] |
Official Symbol | GPN2 |
Synonyms | GPN2; GPN-loop GTPase 2; ATP binding domain 1 family, member B, ATPBD1B; FLJ10349; ATP-binding domain 1 family member B; ATP binding domain 1 family, member B; ATPBD1B; |
Gene ID | 54707 |
mRNA Refseq | NM_018066 |
Protein Refseq | NP_060536 |
UniProt ID | Q9H9Y4 |
◆ Recombinant Proteins | ||
GPN2-1012H | Recombinant Human GPN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATPBD1B-1022H | Recombinant Human ATPBD1B protein, GST-tagged | +Inquiry |
GPN2-1758R | Recombinant Rhesus Macaque GPN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPN2-2080HFL | Recombinant Full Length Human GPN2 Protein, C-Flag-tagged | +Inquiry |
GPN2-5565H | Recombinant Human GPN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPN2-5802HCL | Recombinant Human GPN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPN2 Products
Required fields are marked with *
My Review for All GPN2 Products
Required fields are marked with *