Recombinant Human GPR108 Protein
| Cat.No. : | GPR108-5166H |
| Product Overview : | Human GPR108 ORF (ENSP00000264080) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 208-301 a.a. |
| Description : | GPR108 (G Protein-Coupled Receptor 108) is a Protein Coding gene. An important paralog of this gene is GPR107. |
| Form : | Liquid |
| Molecular Mass : | 10.9 kDa |
| AA Sequence : | MVICYVYFTRIIAILLQVAVPFQWQWLYQLLVEGSTLAFFVLTGYKFQPTGNNPYLQLPQEDEEDVQMEQVMTDSGFREGLSKVNKTASGRELL |
| Applications : | Antibody Production Functional Study Compound Screening |
| Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | GPR108 G protein-coupled receptor 108 [ Homo sapiens ] |
| Official Symbol | GPR108 |
| Synonyms | LUSTR2; GPR108; G protein-coupled receptor 108 |
| Gene ID | 56927 |
| mRNA Refseq | NM_001080452 |
| Protein Refseq | NP_001073921 |
| UniProt ID | Q9NPR9 |
| ◆ Recombinant Proteins | ||
| RFL25246MF | Recombinant Full Length Mouse Protein Gpr108(Gpr108) Protein, His-Tagged | +Inquiry |
| GPR108-7125M | Recombinant Mouse GPR108 Protein | +Inquiry |
| GPR108-5166H | Recombinant Human GPR108 Protein | +Inquiry |
| GPR108-3838M | Recombinant Mouse GPR108 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GPR108-2646R | Recombinant Rat GPR108 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR108 Products
Required fields are marked with *
My Review for All GPR108 Products
Required fields are marked with *
