Recombinant Human GPR108 Protein

Cat.No. : GPR108-5561HF
Product Overview : Human GPR108 ORF (ENSP00000264080) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 208-301 a.a.
Description : GPR108 (G Protein-Coupled Receptor 108) is a Protein Coding gene. An important paralog of this gene is GPR107.
Form : Liquid
Molecular Mass : 10.9 kDa
AA Sequence : MVICYVYFTRIIAILLQVAVPFQWQWLYQLLVEGSTLAFFVLTGYKFQPTGNNPYLQLPQEDEEDVQMEQVMTDSGFREGLSKVNKTASGRELL
Applications : Antibody Production
Functional Study
Compound Screening
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name GPR108 G protein-coupled receptor 108 [ Homo sapiens ]
Official Symbol GPR108
Synonyms LUSTR2; GPR108; G protein-coupled receptor 108
Gene ID 56927
mRNA Refseq NM_001080452
Protein Refseq NP_001073921
MIM 618491
UniProt ID Q9NPR9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPR108 Products

Required fields are marked with *

My Review for All GPR108 Products

Required fields are marked with *

0
cart-icon