Recombinant Human GPR128 Protein, GST-tagged
| Cat.No. : | GPR128-5180H |
| Product Overview : | Human GPR128 partial ORF (NP_116176.1, 31 a.a. - 130 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 31-130 a.a. |
| Description : | ADGRG7 (Adhesion G Protein-Coupled Receptor G7) is a Protein Coding gene. Diseases associated with ADGRG7 include Fibrogenesis Imperfecta Ossium. GO annotations related to this gene include G-protein coupled receptor activity and transmembrane signaling receptor activity. An important paralog of this gene is ADGRF5. |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | RIVIRIQRGKSTSSSSTPTEFCRNGGTWENGRCICTEEWKGLRCTIANFCENSTYMGFTFARIPVGRYGPSLQTCGKDTPNAGNPMAVRLCSLSLYGEIE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GPR128 G protein-coupled receptor 128 [ Homo sapiens ] |
| Official Symbol | GPR128 |
| Synonyms | GPR128; G protein-coupled receptor 128 |
| Gene ID | 84873 |
| mRNA Refseq | NM_032787 |
| Protein Refseq | NP_116176 |
| MIM | 612307 |
| UniProt ID | Q96K78 |
| ◆ Recombinant Proteins | ||
| GPR128-5616HF | Recombinant Full Length Human GPR128 Protein | +Inquiry |
| GPR128-3061H | Recombinant Human GPR128 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GPR128-5179H | Recombinant Human GPR128 Protein | +Inquiry |
| GPR128-1135H | Recombinant Human GPR128 | +Inquiry |
| GPR128-7138M | Recombinant Mouse GPR128 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GPR128-5798HCL | Recombinant Human GPR128 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR128 Products
Required fields are marked with *
My Review for All GPR128 Products
Required fields are marked with *
