Recombinant Human GPR128 Protein, GST-tagged

Cat.No. : GPR128-5180H
Product Overview : Human GPR128 partial ORF (NP_116176.1, 31 a.a. - 130 a.a.) recombinant protein with GST tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 31-130 a.a.
Description : ADGRG7 (Adhesion G Protein-Coupled Receptor G7) is a Protein Coding gene. Diseases associated with ADGRG7 include Fibrogenesis Imperfecta Ossium. GO annotations related to this gene include G-protein coupled receptor activity and transmembrane signaling receptor activity. An important paralog of this gene is ADGRF5.
Molecular Mass : 36.63 kDa
AA Sequence : RIVIRIQRGKSTSSSSTPTEFCRNGGTWENGRCICTEEWKGLRCTIANFCENSTYMGFTFARIPVGRYGPSLQTCGKDTPNAGNPMAVRLCSLSLYGEIE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GPR128 G protein-coupled receptor 128 [ Homo sapiens ]
Official Symbol GPR128
Synonyms GPR128; G protein-coupled receptor 128
Gene ID 84873
mRNA Refseq NM_032787
Protein Refseq NP_116176
MIM 612307
UniProt ID Q96K78

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPR128 Products

Required fields are marked with *

My Review for All GPR128 Products

Required fields are marked with *

0
cart-icon
0
compare icon