Recombinant Human GPR15 Protein, GST-tagged
Cat.No. : | GPR15-5192H |
Product Overview : | Human GPR15 partial ORF (NP_005281.1, 261 a.a. - 360 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 261-360 a.a. |
Description : | This gene encodes a G protein-coupled receptor that acts as a chemokine receptor for human immunodeficiency virus type 1 and 2. The encoded protein localizes to the cell membrane. [provided by RefSeq, Nov 2012] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | KFLAIVSGLRQEHYLPSAILQLGMEVSGPLAFANSCVNPFIYYIFDSYIRRAIVHCLCPCLKNYDFGSSTETSDSHLTKALSTFIHAEDFARRRKRSVSL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GPR15 G protein-coupled receptor 15 [ Homo sapiens ] |
Official Symbol | GPR15 |
Synonyms | GPR15; G protein-coupled receptor 15; G-protein coupled receptor 15; BOB; brother of Bonzo; MGC126828; MGC126830; |
Gene ID | 2838 |
mRNA Refseq | NM_005290 |
Protein Refseq | NP_005281 |
MIM | 601166 |
UniProt ID | P49685 |
◆ Recombinant Proteins | ||
EIF1B-9991Z | Recombinant Zebrafish EIF1B | +Inquiry |
GPR15-1764R | Recombinant Rhesus Macaque GPR15 Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF1B-375H | Recombinant Human EIF1B Protein, MYC/DDK-tagged | +Inquiry |
GPR15-1943R | Recombinant Rhesus monkey GPR15 Protein, His-tagged | +Inquiry |
EIF1B-1677H | Recombinant Human EIF1B Protein (Met1-Phe113), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF1B-244HCL | Recombinant Human EIF1B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPR15 Products
Required fields are marked with *
My Review for All GPR15 Products
Required fields are marked with *
0
Inquiry Basket