Recombinant Human GPR15 Protein, GST-tagged
| Cat.No. : | GPR15-5192H |
| Product Overview : | Human GPR15 partial ORF (NP_005281.1, 261 a.a. - 360 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 261-360 a.a. |
| Description : | This gene encodes a G protein-coupled receptor that acts as a chemokine receptor for human immunodeficiency virus type 1 and 2. The encoded protein localizes to the cell membrane. [provided by RefSeq, Nov 2012] |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | KFLAIVSGLRQEHYLPSAILQLGMEVSGPLAFANSCVNPFIYYIFDSYIRRAIVHCLCPCLKNYDFGSSTETSDSHLTKALSTFIHAEDFARRRKRSVSL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GPR15 G protein-coupled receptor 15 [ Homo sapiens ] |
| Official Symbol | GPR15 |
| Synonyms | GPR15; G protein-coupled receptor 15; G-protein coupled receptor 15; BOB; brother of Bonzo; MGC126828; MGC126830; |
| Gene ID | 2838 |
| mRNA Refseq | NM_005290 |
| Protein Refseq | NP_005281 |
| MIM | 601166 |
| UniProt ID | P49685 |
| ◆ Recombinant Proteins | ||
| EIF1B-483C | Recombinant Cynomolgus EIF1B Protein, His-tagged | +Inquiry |
| EIF1B-3480H | Recombinant Human EIF1B, His-tagged | +Inquiry |
| RFL27731PF | Recombinant Full Length Pan Troglodytes G-Protein Coupled Receptor 15(Gpr15) Protein, His-Tagged | +Inquiry |
| GPR15-710H | Recombinant Human GPR15 Full Length Transmembrane protein, His-tagged | +Inquiry |
| EIF1B-4786H | Recombinant Human EIF1B Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EIF1B-244HCL | Recombinant Human EIF1B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR15 Products
Required fields are marked with *
My Review for All GPR15 Products
Required fields are marked with *




