Recombinant Human GPR15 Full Length Transmembrane protein, His-tagged
Cat.No. : | GPR15-710H |
Product Overview : | Recombinant Human GPR15 protein(P49685)(1-360aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-360aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43.6 kDa |
AA Sequence : | MDPEETSVYLDYYYATSPNSDIRETHSHVPYTSVFLPVFYTAVFLTGVLGNLVLMGALHFKPGSRRLIDIFIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCSVLLLTCMSVDRYLAIVWPVVSRKFRRTDCAYVVCASIWFISCLLGLPTLLSRELTLIDDKPYCAEKKATPIKLIWSLVALIFTFFVPLLSIVTCYCCIARKLCAHYQQSGKHNKKLKKSIKIIFIVVAAFLVSWLPFNTFKFLAIVSGLRQEHYLPSAILQLGMEVSGPLAFANSCVNPFIYYIFDSYIRRAIVHCLCPCLKNYDFGSSTETSDSHLTKALSTFIHAEDFARRRKRSVSL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | GPR15 G protein-coupled receptor 15 [ Homo sapiens ] |
Official Symbol | GPR15 |
Synonyms | GPR15; G protein-coupled receptor 15; G-protein coupled receptor 15; BOB; brother of Bonzo; MGC126828; MGC126830; |
Gene ID | 2838 |
mRNA Refseq | NM_005290 |
Protein Refseq | NP_005281 |
MIM | 601166 |
UniProt ID | P49685 |
◆ Recombinant Proteins | ||
EIF1B-4786H | Recombinant Human EIF1B Protein, GST-tagged | +Inquiry |
RFL21694HF | Recombinant Full Length Human G-Protein Coupled Receptor 15(Gpr15) Protein, His-Tagged | +Inquiry |
EIF1B-483C | Recombinant Cynomolgus EIF1B Protein, His-tagged | +Inquiry |
EIF1B-1413R | Recombinant Rhesus monkey EIF1B Protein, His-tagged | +Inquiry |
EIF1B-3035H | Recombinant Human EIF1B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF1B-244HCL | Recombinant Human EIF1B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR15 Products
Required fields are marked with *
My Review for All GPR15 Products
Required fields are marked with *