Recombinant Human GPR157 Full Length Transmembrane protein (1-335 aa), His-tagged
Cat.No. : | GPR157-2729H |
Product Overview : | Recombinant Human GPR157 Protein (1-335 aa) is produced by in vitro E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-335aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.4 kDa |
AA Sequence : | MQPSPPPTELVPSERAVVLLSCALSALGSGLLVATHALWPDLRSRARRLLLFLSLADLLSAASYFYGVLQNFAGPSWDCVLQGALSTFANTSSFFWTVAIALYLYLSIVRAARGPRTDRLLWAFHVVSWGVPLVITVAAVALKKIGYDASDVSVGWCWIDLEAKDHVLWMLLTGKLWEMLAYVLLPLLYLLVRKHINRAHTALSEYRPILSQEHRLLRHSSMADKKLVLIPLIFIGLRVWSTVRFVLTLCGSPAVQTPVLVVLHGIGNTFQGGANCIMFVLCTRAVRTRLFSLCCCCCSSQPPTKSPAGTPKAPAPSKPGESQESQGTPGELPST |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
GPR157-5464HF | Recombinant Full Length Human GPR157 Protein, GST-tagged | +Inquiry |
RFL11188HF | Recombinant Full Length Human G-Protein Coupled Receptor 157(Gpr157) Protein, His-Tagged | +Inquiry |
GPR157-2655R | Recombinant Rat GPR157 Protein | +Inquiry |
GPR157-5201H | Recombinant Human GPR157 Protein, GST-tagged | +Inquiry |
GPR157-3432Z | Recombinant Zebrafish GPR157 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPR157-741HCL | Recombinant Human GPR157 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPR157 Products
Required fields are marked with *
My Review for All GPR157 Products
Required fields are marked with *
0
Inquiry Basket