Recombinant Human GPR162 Protein
| Cat.No. : | GPR162-5206H |
| Product Overview : | Human GPR162 full-length ORF (NP_055264.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | This gene was identified upon genomic analysis of a gene-dense region at human chromosome 12p13. It appears to be mainly expressed in the brain; however, its function is not known. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq |
| Form : | Liquid |
| Molecular Mass : | 33.1 kDa |
| AA Sequence : | MLSTGVVSFFSLKSDSAPPWMVLAVLWCSMAQTLLLPSFIWSCERYRADVRTVWEQCVAIMSEEDGDDDGGCDDYAEGRVCKVRFDANGATGPGSRDPAQVKLLPGRHMLFPPLERVHYLQVPLSRRLSHDETNIFSTPREPGSFLHKWSSSDDIRVLPAQSRALGGPPEYLGQRHRLEDEEDEEEAEGGGLASLRQFLESGVLGSGGGPPRGPGFFREEITTFIDETPLPSPTASPGHSPRRPRPLGLSPRRLSLGSPESRAVGLPLGLSAGRRCSLTGGEESARAWGGSWGPGNPIFPQLTL |
| Applications : | Antibody Production Functional Study Compound Screening |
| Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | GPR162 G protein-coupled receptor 162 [ Homo sapiens ] |
| Official Symbol | GPR162 |
| Synonyms | A-2; GRCA; GPR162; G protein-coupled receptor 162 |
| Gene ID | 27239 |
| mRNA Refseq | NM_019858 |
| Protein Refseq | NP_062832 |
| UniProt ID | Q16538 |
| ◆ Recombinant Proteins | ||
| RFL34677HF | Recombinant Full Length Human Probable G-Protein Coupled Receptor 162(Gpr162) Protein, His-Tagged | +Inquiry |
| GPR162-5206H | Recombinant Human GPR162 Protein | +Inquiry |
| GPR162-7161M | Recombinant Mouse GPR162 Protein | +Inquiry |
| GPR162-5207H | Recombinant Human GPR162 Protein, GST-tagged | +Inquiry |
| GPR162-5474HF | Recombinant Full Length Human GPR162 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GPR162-742HCL | Recombinant Human GPR162 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR162 Products
Required fields are marked with *
My Review for All GPR162 Products
Required fields are marked with *
