Recombinant Human GPR17 Protein, GST-tagged
| Cat.No. : | GPR17-5209H |
| Product Overview : | Human GPR17 full-length ORF ( AAH31653, 1 a.a. - 339 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | GPR17 (G Protein-Coupled Receptor 17) is a Protein Coding gene. Diseases associated with GPR17 include Suppression Amblyopia. Among its related pathways are Nucleotide-like (purinergic) receptors and RET signaling. GO annotations related to this gene include G-protein coupled receptor activity and chemokine receptor activity. An important paralog of this gene is P2RY4. |
| Molecular Mass : | 63.03 kDa |
| AA Sequence : | MNGLEVAPPGLITNFSLATAEQCGQETPLENMLFASFYLLDFILALVGNTLALWFFIRDHKSGTPANVFLMHLAVADLSCVLVLPTRLVYHFSGNHWPFGEIACRLTGFLFYLNMYASIYFLTCISADRFLAIVHPVKSLKLRRPLYAHLACAFLWVVVAVAMAPLLVSPQTVQTNHTVVCLQLYREKASHHALVSLAVAFTFPFITTVTCYLLIIRSLRQGLRVEKRLKTKAVRMIAIVLAIFLVCFVPYHVNRSVYVLHYRSHGASCATQRILALANRITSCLTSLNGALDPIMYFFVAEKFRHALCNLLCGKRLKGPPPSFEGKTNESSLSAKSEL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GPR17 G protein-coupled receptor 17 [ Homo sapiens ] |
| Official Symbol | GPR17 |
| Synonyms | GPR17; G protein-coupled receptor 17; uracil nucleotide/cysteinyl leukotriene receptor; R12; P2Y-like receptor; UDP/CysLT receptor; G-protein coupled receptor 17; DKFZp686M18273; |
| Gene ID | 2840 |
| mRNA Refseq | NM_001161415 |
| Protein Refseq | NP_001154887 |
| MIM | 603071 |
| UniProt ID | Q13304 |
| ◆ Recombinant Proteins | ||
| RFL14842HF | Recombinant Full Length Human Uracil Nucleotide/Cysteinyl Leukotriene Receptor(Gpr17) Protein, His-Tagged | +Inquiry |
| GPR17-04HCL | Recombinant Human GPR17 Over-expression Lysate, C-MYC/DDK-tagged | +Inquiry |
| GPR17-2810H | Recombinant Human GPR17 Protein (Arg283-Leu367), N-GST tagged | +Inquiry |
| GPR17-13460H | Recombinant Human GPR17, GST-tagged | +Inquiry |
| GPR17-5479HF | Recombinant Full Length Human GPR17 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR17 Products
Required fields are marked with *
My Review for All GPR17 Products
Required fields are marked with *




