Recombinant Full Length Human Uracil Nucleotide/Cysteinyl Leukotriene Receptor(Gpr17) Protein, His-Tagged
Cat.No. : | RFL14842HF |
Product Overview : | Recombinant Full Length Human Uracil nucleotide/cysteinyl leukotriene receptor(GPR17) Protein (Q13304) (1-367aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-367) |
Form : | Lyophilized powder |
AA Sequence : | MSKRSWWAGSRKPPREMLKLSGSDSSQSMNGLEVAPPGLITNFSLATAEQCGQETPLENM LFASFYLLDFILALVGNTLALWLFIRDHKSGTPANVFLMHLAVADLSCVLVLPTRLVYHF SGNHWPFGEIACRLTGFLFYLNMYASIYFLTCISADRFLAIVHPVKSLKLRRPLYAHLAC AFLWVVVAVAMAPLLVSPQTVQTNHTVVCLQLYREKASHHALVSLAVAFTFPFITTVTCY LLIIRSLRQGLRVEKRLKTKAVRMIAIVLAIFLVCFVPYHVNRSVYVLHYRSHGASCATQ RILALANRITSCLTSLNGALDPIMYFFVAEKFRHALCNLLCGKRLKGPPPSFEGKTNESS LSAKSEL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GPR17 |
Synonyms | GPR17; Uracil nucleotide/cysteinyl leukotriene receptor; UDP/CysLT receptor; G-protein coupled receptor 17; P2Y-like receptor; R12 |
UniProt ID | Q13304 |
◆ Recombinant Proteins | ||
GPR17-5209H | Recombinant Human GPR17 Protein, GST-tagged | +Inquiry |
GPR17-1767R | Recombinant Rhesus Macaque GPR17 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPR17-5477HF | Recombinant Full Length Human GPR17 Protein | +Inquiry |
GPR17-2810H | Recombinant Human GPR17 Protein (Arg283-Leu367), N-GST tagged | +Inquiry |
RFL14842HF | Recombinant Full Length Human Uracil Nucleotide/Cysteinyl Leukotriene Receptor(Gpr17) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPR17 Products
Required fields are marked with *
My Review for All GPR17 Products
Required fields are marked with *
0
Inquiry Basket