Recombinant Human GPR180 Protein, GST-tagged

Cat.No. : GPR180-4944H
Product Overview : Human ITR partial ORF ( NP_851320.1, 21 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein that is a member of the G protein-coupled receptor superfamily. This protein is produced predominantly in vascular smooth muscle cells and may play an important role in the regulation of vascular remodeling. [provided by RefSeq
Molecular Mass : 36.74 kDa
AA Sequence : QGKTLRGSFSSTAAQDAQGQRIGHFEFHGDHALLCVRINNIAVAVGKEAKLYLFQAQEWLKLQQSSHGYSCSEKLSKAQLTMTMNQTEHNLTVSQIPSPQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GPR180 G protein-coupled receptor 180 [ Homo sapiens ]
Official Symbol GPR180
Synonyms GPR180; G protein-coupled receptor 180; integral membrane protein GPR180; intimal thickness related receptor; ITR; intimal thickness-related receptor; DKFZp586C1322; DKFZp667K0825;
Gene ID 160897
mRNA Refseq NM_180989
Protein Refseq NP_851320
MIM 607787
UniProt ID Q86V85

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPR180 Products

Required fields are marked with *

My Review for All GPR180 Products

Required fields are marked with *

0
cart-icon
0
compare icon