Recombinant Human GPR180 Protein, GST-tagged
Cat.No. : | GPR180-4944H |
Product Overview : | Human ITR partial ORF ( NP_851320.1, 21 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that is a member of the G protein-coupled receptor superfamily. This protein is produced predominantly in vascular smooth muscle cells and may play an important role in the regulation of vascular remodeling. [provided by RefSeq |
Molecular Mass : | 36.74 kDa |
AA Sequence : | QGKTLRGSFSSTAAQDAQGQRIGHFEFHGDHALLCVRINNIAVAVGKEAKLYLFQAQEWLKLQQSSHGYSCSEKLSKAQLTMTMNQTEHNLTVSQIPSPQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GPR180 G protein-coupled receptor 180 [ Homo sapiens ] |
Official Symbol | GPR180 |
Synonyms | GPR180; G protein-coupled receptor 180; integral membrane protein GPR180; intimal thickness related receptor; ITR; intimal thickness-related receptor; DKFZp586C1322; DKFZp667K0825; |
Gene ID | 160897 |
mRNA Refseq | NM_180989 |
Protein Refseq | NP_851320 |
MIM | 607787 |
UniProt ID | Q86V85 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR180 Products
Required fields are marked with *
My Review for All GPR180 Products
Required fields are marked with *