Recombinant Human GPR37 Protein, His-tagged
| Cat.No. : | GPR37-541H |
| Product Overview : | Recombinant Human GPR37 Protein(34-264 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 34-264 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AASequence : | SRNETCLGESCAPTVIQRRGRDAWGPGNSARDVLRARAPREEQGAAFLAGPSWDLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPWRWKGARGQEPSETLGRGNPTALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLFYWPRRAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYGAYAV |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| Gene Name | GPR37 G protein-coupled receptor 37 (endothelin receptor type B-like) [ Homo sapiens ] |
| Official Symbol | GPR37 |
| Synonyms | GPR37; G protein-coupled receptor 37 (endothelin receptor type B-like); probable G-protein coupled receptor 37; EDNRBL; hET(B)R LP; PAELR; ETBR-LP-1; endothelin B receptor-like protein 1; Parkin-associated endothelin receptor-like receptor; hET(B)R-LP; |
| Gene ID | 2861 |
| mRNA Refseq | NM_005302 |
| Protein Refseq | NP_005293 |
| MIM | 602583 |
| UniProt ID | O15354 |
| ◆ Recombinant Proteins | ||
| RFL6347RF | Recombinant Full Length Rat Probable G-Protein Coupled Receptor 37(Gpr37) Protein, His-Tagged | +Inquiry |
| GPR37-541H | Recombinant Human GPR37 Protein, His-tagged | +Inquiry |
| GPR37-2320R | Recombinant Rat GPR37 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GPR37-5237H | Recombinant Human GPR37 Protein, GST-tagged | +Inquiry |
| GPR37-1953R | Recombinant Rhesus monkey GPR37 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GPR37-1593HCL | Recombinant Human GPR37 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR37 Products
Required fields are marked with *
My Review for All GPR37 Products
Required fields are marked with *




