Recombinant Human GPR42 Protein, GST-tagged

Cat.No. : GPR42-5245H
Product Overview : Human GPR42 full-length ORF ( AAI56086.1, 1 a.a. - 346 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : GPR42 (G Protein-Coupled Receptor 42 (Gene/Pseudogene)) is a Protein Coding gene. Among its related pathways are Peptide ligand-binding receptors. GO annotations related to this gene include G-protein coupled receptor activity. An important paralog of this gene is FFAR3.
Molecular Mass : 38.1 kDa
AA Sequence : MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLRCRPVAVDVLLLNLTASDLLLLLFLPFRMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHPLWYKTRPRLGQAGLVSVACWLLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFWKDQLAILLPVRLEMAVVLFVVPLIITSYCYSRLVWILGRGGSHRRQRRVAGLVAATLLNFLVCFGPYNVSHVVGYICGESPVWRIYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAEN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GPR42 G protein-coupled receptor 42 (gene/pseudogene) [ Homo sapiens (human) ]
Official Symbol GPR42
Synonyms GPR42; G protein-coupled receptor 42 (gene/pseudogene); FFAR1L; FFAR3L; GPR41L; GPR42P; G-protein coupled receptor 42; G protein-coupled receptor 42 pseudogene; G-protein coupled receptor
Gene ID 2866
mRNA Refseq NM_001348195
Protein Refseq NP_001335124
MIM 603822
UniProt ID O15529

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPR42 Products

Required fields are marked with *

My Review for All GPR42 Products

Required fields are marked with *

0
cart-icon
0
compare icon