Recombinant Human GPR42 Protein, GST-tagged

• Cat.No.: GPR42-5245H
• Product Overview: Human GPR42 full-length ORF ( AAI56086.1, 1 a.a. - 346 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: GPR42 (G Protein-Coupled Receptor 42 (Gene/Pseudogene)) is a Protein Coding gene. Among its related pathways are Peptide ligand-binding receptors. GO annotations related to this gene include G-protein coupled receptor activity. An important paralog of this gene is FFAR3.
• Molecular Mass: 38.1 kDa
• AA Sequence: MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLRCRPVAVDVLLLNLTASDLLLLLFLPFRMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHPLWYKTRPRLGQAGLVSVACWLLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFWKDQLAILLPVRLEMAVVLFVVPLIITSYCYSRLVWILGRGGSHRRQRRVAGLVAATLLNFLVCFGPYNVSHVVGYICGESPVWRIYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAEN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GPR42 G protein-coupled receptor 42 (gene/pseudogene) [ Homo sapiens (human) ]
• Official Symbol: GPR42
• Synonyms: GPR42; G protein-coupled receptor 42 (gene/pseudogene); FFAR1L; FFAR3L; GPR41L; GPR42P; G-protein coupled receptor 42; G protein-coupled receptor 42 pseudogene; G-protein coupled receptor
• Gene ID: 2866
• mRNA Refseq: NM_001348195
• Protein Refseq: NP_001335124
• MIM: 603822
• UniProt ID: O15529