Recombinant Human GPR87 protein, GST-tagged
Cat.No. : | GPR87-301229H |
Product Overview : | Recombinant Human GPR87 (1-47 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Val47 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPV |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | GPR87 G protein-coupled receptor 87 [ Homo sapiens ] |
Official Symbol | GPR87 |
Synonyms | GPR87; G protein-coupled receptor 87; GPR95; G-protein coupled receptor 87; orphan GPCR 87; G protein-coupled receptor 95; G-protein coupled receptor 95; FKSG78; KPG_002; MGC131898; |
Gene ID | 53836 |
mRNA Refseq | NM_023915 |
Protein Refseq | NP_076404 |
MIM | 606379 |
UniProt ID | Q9BY21 |
◆ Recombinant Proteins | ||
GPR87-5499HF | Recombinant Full Length Human GPR87 Protein | +Inquiry |
GPR87-575H | Active Recombinant Human GPR87 Full Length Transmembrane protein(VLPs) | +Inquiry |
GPR87-301229H | Recombinant Human GPR87 protein, GST-tagged | +Inquiry |
RFL2668HF | Recombinant Full Length Human G-Protein Coupled Receptor 87(Gpr87) Protein, His-Tagged | +Inquiry |
GPR87-5275H | Recombinant Human GPR87 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR87 Products
Required fields are marked with *
My Review for All GPR87 Products
Required fields are marked with *
0
Inquiry Basket