Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human GPR87 protein, GST-tagged

Cat.No. : GPR87-301229H
Product Overview : Recombinant Human GPR87 (1-47 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
Source : E. coli
Species : Human
Tag : GST
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Protein length : Met1-Val47
AA Sequence : MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPV
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name : GPR87 G protein-coupled receptor 87 [ Homo sapiens ]
Official Symbol : GPR87
Synonyms : GPR87; G protein-coupled receptor 87; GPR95; G-protein coupled receptor 87; orphan GPCR 87; G protein-coupled receptor 95; G-protein coupled receptor 95; FKSG78; KPG_002; MGC131898;
Gene ID : 53836
mRNA Refseq : NM_023915
Protein Refseq : NP_076404
MIM : 606379
UniProt ID : Q9BY21

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends