Recombinant Human GPR97 protein, His-tagged

• Cat.No.: GPR97-6113H
• Product Overview: Recombinant Human GPR97 protein(23-274 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 23-274 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: KPTEGPRNTCLGSNNMYDIFNLNDKALCFTKCRQSGSDSCNVENLQRYWLNYEAHLMKEGLTQKVNTPFLKALVQNLSTNTAEDFYFSLEPSQVPRQVMKDEDKPPDRVRLPKSLFRSLPGNRSVVRLAVTILDIGPGTLFKGPRLGLGDGSGVLNNRLVGLSVGQMHVTKLAEPLEIVFSHQRPPPNMTLTCVFWDVTKGTTGDWSSEGCSTEVRPEGTVCCCDHLTFFALLLRPTLDQSTVHILTRISQA
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: GPR97 G protein-coupled receptor 97 [ Homo sapiens ]
• Official Symbol: GPR97
• Synonyms: GPR97; G protein-coupled receptor 97; probable G-protein coupled receptor 97; Pb99; PGR26; G-protein coupled receptor PGR26; PB99
• Gene ID: 222487
• mRNA Refseq: NM_170776
• Protein Refseq: NP_740746
• UniProt ID: Q86Y34