Recombinant Human GPRC5D protein(261-345aa), His-tagged
Cat.No. : | GPRC5D-1399H |
Product Overview : | Recombinant Human GPRC5D protein(Q9NZD1)(261-345aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 261-345aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 13.4 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | ELCILYRSCRQECPLQGNACPVTAYQHSFQVENQELSRARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV |
Gene Name | GPRC5D G protein-coupled receptor, family C, group 5, member D [ Homo sapiens ] |
Official Symbol | GPRC5D |
Synonyms | GPRC5D; G protein-coupled receptor, family C, group 5, member D; G-protein coupled receptor family C group 5 member D; orphan G-protein coupled receptor; MGC129713; MGC129714; |
Gene ID | 55507 |
mRNA Refseq | NM_018654 |
Protein Refseq | NP_061124 |
MIM | 607437 |
UniProt ID | Q9NZD1 |
◆ Cell & Tissue Lysates | ||
GPRC5D-749HCL | Recombinant Human GPRC5D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPRC5D Products
Required fields are marked with *
My Review for All GPRC5D Products
Required fields are marked with *