Recombinant Human GPX4 Protein, N-His-tagged

Cat.No. : GPX4-1894H
Product Overview : Recombinant Human GPX4 Protein with a N-His-tag was expressed in E. coli.
Availability August 02, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of hydrogen peroxide, organic hydroperoxides and lipid hydroperoxides, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme has a high preference for lipid hydroperoxides and protects cells against membrane lipid peroxidation and cell death. It is also required for normal sperm development; thus, it has been identified as a 'moonlighting' protein because of its ability to serve dual functions as a peroxidase, as well as a structural protein in mature spermatozoa. Mutations in this gene are associated with Sedaghatian type of spondylometaphyseal dysplasia (SMDS). This isozyme is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Transcript variants resulting from alternative splicing or use of alternate promoters have been described to encode isoforms with different subcellular localization.
Molecular Mass : ~ 21.3 kDa, reducing conditions
AA Sequence : MHHHHHHENLYFQSMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQCGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF
Endotoxin : < 1 EU/μg
Purity : >90%, by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.125 mg/mL
Storage Buffer : Supplied as a 0.2 μm filtered solution in 30 mM Tris, 300mM NaCl, pH 9.0
Gene Name GPX4 glutathione peroxidase 4 [ Homo sapiens (human) ]
Official Symbol GPX4
Synonyms GPX4; glutathione peroxidase 4; MCSP; SMDS; GPx-4; PHGPx; snGPx; GSHPx-4; snPHGPx; phospholipid hydroperoxide glutathione peroxidase; epididymis secretory sperm binding protein; phospholipid hydroperoxidase; phospholipid hydroperoxide glutathione peroxidase, mitochondrial; selenoprotein GPX4; sperm nucleus glutathione peroxidase; EC 1.11.1.12
Gene ID 2879
mRNA Refseq NM_002085
Protein Refseq NP_002076
MIM 138322
UniProt ID P36969

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPX4 Products

Required fields are marked with *

My Review for All GPX4 Products

Required fields are marked with *

0
cart-icon