Recombinant Human GPX7, FLAG-tagged

Cat.No. : GPX7-29078TH
Product Overview : Recombinant full length Human Glutathione Peroxidase 7 with a C terminal DDDDK tag; mwt: 22 kDa by SDS PAGE.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Flag
Protein Length : 187 amino acids
Conjugation : FLAG
Molecular Weight : 22.000kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: PBS, pH 7.2
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL
Sequence Similarities : Belongs to the glutathione peroxidase family.
Gene Name GPX7 glutathione peroxidase 7 [ Homo sapiens ]
Official Symbol GPX7
Synonyms GPX7; glutathione peroxidase 7; FLJ14777; GPX6; NPGPx;
Gene ID 2882
mRNA Refseq NM_015696
Protein Refseq NP_056511
Uniprot ID Q96SL4
Chromosome Location 1p32
Pathway Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Glutathione metabolism, organism-specific biosystem; Glutathione metabolism, conserved biosystem; glutathione redox reactions I, organism-specific biosystem;
Function glutathione peroxidase activity; oxidoreductase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPX7 Products

Required fields are marked with *

My Review for All GPX7 Products

Required fields are marked with *

0
cart-icon
0
compare icon