Recombinant Human GPX7, FLAG-tagged

• Cat.No.: GPX7-29078TH
• Product Overview: Recombinant full length Human Glutathione Peroxidase 7 with a C terminal DDDDK tag; mwt: 22 kDa by SDS PAGE.

Specification

• Species: Human
• Source: HEK293
• Tag: Flag
• Protein Length: 187 amino acids
• Conjugation: FLAG
• Molecular Weight: 22.000kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: PBS, pH 7.2
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL
• Sequence Similarities: Belongs to the glutathione peroxidase family.

Gene Information

• Gene Name: GPX7 glutathione peroxidase 7 [ Homo sapiens ]
• Official Symbol: GPX7
• Synonyms: GPX7; glutathione peroxidase 7; FLJ14777; GPX6; NPGPx
• Gene ID: 2882
• mRNA Refseq: NM_015696
• Protein Refseq: NP_056511
• Uniprot ID: Q96SL4
• Chromosome Location: 1p32
• Pathway: Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Glutathione metabolism, organism-specific biosystem; Glutathione metabolism, conserved biosystem; glutathione redox reactions I, organism-specific biosystem
• Function: glutathione peroxidase activity; oxidoreductase activity