Recombinant Human GPX7, FLAG-tagged
Cat.No. : | GPX7-29078TH |
Product Overview : | Recombinant full length Human Glutathione Peroxidase 7 with a C terminal DDDDK tag; mwt: 22 kDa by SDS PAGE. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Flag |
Protein Length : | 187 amino acids |
Conjugation : | FLAG |
Molecular Weight : | 22.000kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: PBS, pH 7.2 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL |
Sequence Similarities : | Belongs to the glutathione peroxidase family. |
Gene Name | GPX7 glutathione peroxidase 7 [ Homo sapiens ] |
Official Symbol | GPX7 |
Synonyms | GPX7; glutathione peroxidase 7; FLJ14777; GPX6; NPGPx; |
Gene ID | 2882 |
mRNA Refseq | NM_015696 |
Protein Refseq | NP_056511 |
Uniprot ID | Q96SL4 |
Chromosome Location | 1p32 |
Pathway | Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Glutathione metabolism, organism-specific biosystem; Glutathione metabolism, conserved biosystem; glutathione redox reactions I, organism-specific biosystem; |
Function | glutathione peroxidase activity; oxidoreductase activity; |
◆ Recombinant Proteins | ||
GPX7-5314H | Recombinant Human GPX7 Protein, GST-tagged | +Inquiry |
GPX7-2234H | Recombinant Human GPX7 Protein, MYC/DDK-tagged | +Inquiry |
GPX7-1966R | Recombinant Rhesus monkey GPX7 Protein, His-tagged | +Inquiry |
GPX7-7341H | Recombinant Human GPX7 protein(Met1-Leu187), hFc-tagged | +Inquiry |
GPX7-3816H | Recombinant Human GPX7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPX7-1528HCL | Recombinant Human GPX7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPX7 Products
Required fields are marked with *
My Review for All GPX7 Products
Required fields are marked with *