Recombinant Human GPX8 Protein, GST-tagged
Cat.No. : | GPX8-5315H |
Product Overview : | Human GPX8 full-length ORF ( NP_001008398.1, 1 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GPX8 (Glutathione Peroxidase 8 (Putative)) is a Protein Coding gene. Among its related pathways are Glutathione metabolism and Cellular Senescence. GO annotations related to this gene include oxidoreductase activity and peroxidase activity. An important paralog of this gene is GPX7. |
Molecular Mass : | 50.3 kDa |
AA Sequence : | MEPLAAYPLKCSGPRAKVFAVLLSIVLCTVTLFLLQLKFLKPKINSFYAFEVKDAKGRTVSLEKYKGKVSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSKEVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKFWRPEEPIEVIRPDIAALVRQVIIKKKEDL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GPX8 glutathione peroxidase 8 (putative) [ Homo sapiens ] |
Official Symbol | GPX8 |
Synonyms | GPX8; glutathione peroxidase 8 (putative); probable glutathione peroxidase 8; EPLA847; UNQ847; GPx-8; GSHPx-8; |
Gene ID | 493869 |
mRNA Refseq | NM_001008397 |
Protein Refseq | NP_001008398 |
MIM | 617172 |
UniProt ID | Q8TED1 |
◆ Recombinant Proteins | ||
GPX8-5315H | Recombinant Human GPX8 Protein, GST-tagged | +Inquiry |
RFL5612HF | Recombinant Full Length Human Probable Glutathione Peroxidase 8(Gpx8) Protein, His-Tagged | +Inquiry |
GPX8-5589HF | Recombinant Full Length Human GPX8 Protein, GST-tagged | +Inquiry |
GPX8-7236M | Recombinant Mouse GPX8 Protein | +Inquiry |
GPX8-3565H | Recombinant Human GPX8 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPX8-5761HCL | Recombinant Human GPX8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPX8 Products
Required fields are marked with *
My Review for All GPX8 Products
Required fields are marked with *